PRGDB00064369 (Zm.94908)

From PRG Wiki
Revision as of 13:14, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.94908
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21210141 (AY107063)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays PCO100324 mRNA sequence

DNA Sequence

GCACGAGGGGAATCCCTGGCTCTAAACAAGCCCTAAACTTTTTACAAGTGGGCATATTAGCATATACCATACAGTTTTCCATAAAAGAACAGTCATACAATCACAACATCAGAACGCTCTGGAGTCGACCGTGGACTTCGAAAATTCTCTTCAGCGGCAGCGCTAAACCATAAGGCAATggcggcggcggcggcgAAGAGTGTATGCGTGACCGGCGCGGGAGGCTTCATCGCGTCTTGGCTCGTGAAGCTCCTCCTCTCCCGTGGTCAGTACGTGGTCCGCGGCACCGTGCGCGACCCTGGTGCTAGCAAGAATGCTCATCTCAAGGAGTTGGAGCGGGCTGGGGAAAGGTTGCAGCTTCTCCAGGCTGATTTGTTGGACTACAGCAGTGTTGCATCAGCAATTGCTGGCTGTGAGGGTGTCTTCCATGTAGCTTGCCCTGTCCCTTCTGGTCGGTCCTCCAACCCCAAGGTGGAGGTCATAGGTCCTGCTGTAGTAGGAACAACCAATGTGTTAAAGGCTTGCTATGAGGCAAAAGTTAAGCGAGTTGTGGTGGTGTCTTCTGTTTCAGCTGTATTCAGTAACCCTAATTGGCCTAAGGACAAGGTCTTTGATGAAGACTCTTGGTCAGACGAGGATTATTGCAGGAAGAATGAGGATTGGTATTATCTTTCTAAAACTCTATCCGAACGTGAGGCTTTTGCTTTTGCAGCAAAATCGGGGCTGAATGTTGTAACTATTTGCCCGTCCTTGGGTATTTGGGCCCTTGATGCAGTCTATAGTAAATACGAACAGTAAAGTACTCCTTAATTATTTCAAAGGAGATCGTGAGACTGTTGAAAACAGACTCAGAAATATGTGGATGTTCGTGATGTTGCTGATCTCCTGTTCTGCTTACGAAAATCAAGAAGCATCTGGACGATACATCTGCAGCTCGCACCATTAAAANTTCTGATATGATAAACATATTGAAGACTTAANCATCTACCTANCCNAAAC


Protein sequences

Name Description Sequence
Zm.94908 translated coding region predicted by ESTScan from UniGene Zm.94908

MAAAAAKSVCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICPSLGIWALDAVYSKYEQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
1-192 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MAAAAAKSVCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICPSL

HMMPanther: PTHR10366:SF74
1-192 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MAAAAAKSVCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICPSL

Gene3D: G3DSA:3.40.50.720
IPR016040
7-191 no description
NAD(P)-binding domain

KSVCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICPS

superfamily: SSF51735
7-192 NAD(P)-binding Rossmann-fold domains

KSVCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICPSL

HMMPfam: PF01370
IPR001509
9-190 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIASWLVKLLLSRGQYVVRGTVRDPGASKNAHLKELERAGERLQLLQADLLDYSSVASAIAGCEGVFHVACPVPSGRSSNPKVEVIGPAVVGTTNVLKACYEAKVKRVVVVSSVSAVFSNPNWPKDKVFDEDSWSDEDYCRKNEDWYYLSKTLSEREAFAFAAKSGLNVVTICP

Coil: coil
45-66 coiled-coil

KNAHLKELERAGERLQLLQADL

Seg: seg
119-133 seg

AKVKRVVVVSSVSAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox