PRGDB00064604 (Zm.140315)

From PRG Wiki
Revision as of 13:07, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.140315
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 91049531 (EB159949)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

ZM_BFb0296H20.r ZM_BFb Zea mays cDNA 5', mRNA sequence

DNA Sequence

CGAAAACACTAATGGCAGTGCAGTTCTAACAACGACAAGTCGTCAGATCTGGGAACATGAGAACTGGAGGCCATCTGGGGATGACAAGTCGGATTCTGACGCAGAGCAGTTAGAGCCTCATTTGGACGTCACAACCCCCGCGGATGTCCTCCCAGCGTCTTCCCCGAGCAAGAGCAAGGTGGTGGCCCATGTGGAACTCCGCCACGACGACCCAGATTCCTCTGCATTTGGAATCCCGCAAGTAGCAGGGGATACTCAACCTGAGCTCCGCCTTTTCCCCGAGGCGGATGCGGATCTTAAAGGGTTCTTCTACGAAAACCTATTTGGATCGGAAGACAAGTGCCCTGATGATCTGAAAGATATATGTAAAGATCTCATACAAATATCTGCTGGTGTCCTATCAGATGCCTATGAGACCGTGGAAGAGCTCAGAGGTATTACCTACGACACTGGAAAGCTGGCAGCCTGTGTATCAGAGAAGAAAATTCGAGCTCTCTTATCCCAAACTACCTGGCCATCTAAAGGATTGCTTAAGATATTTTAGTATGTTTCCAAAAGGTTACGAGATCAGTGCAGAACGCTTAGTTTGGGCGTGGATAGCTCAAGGTTTCGTAAAGGAGACTCAGGGACAGAATGATTTGGAGAAAGTCGGAAAGAAGTACCTTATTGACCTTATAAGCAGAAAGATGATCGAAGCAGTGGAGGTTCATGCTGATGGTATGGCCCTCTCATGCCGTGCGTACGATTTGTTGCATGGCTTGATCGTTTCATTGTCAACAGAAGAAAAATTCGTTGAAAATCTAAATGACTCGCAGT


Protein sequences

Name Description Sequence
Zm.140315 translated coding region predicted by ESTScan from UniGene Zm.140315

XENTNGSAVLTTTSRQIWEHENWRPSGDDKSDSDAEQLEPHLDVTTPADVLPASSPSKSKVVAHVELRHDDPDSSAFGIPQVAGDTQPELRLFPEADADLKGFFYENLFGSEDKCPDDLKDICKDLIQISAGVLSDAYETVEELRGITYDTGKLAACVSEKKIRALLSQTTWPSKGLLKIFYMFPKGYEISAERLVWAWIAQGFVKETQGQNDLEKVGKKYLIDLISRKMIEAVEVHADGMALSCRAYDLLHGLIVSLSTEEKFVENLNDSQX







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox