PRGDB00064652 (Aan.44)

From PRG Wiki
Revision as of 13:06, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.44
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 154707952 (EV780878)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

PY-2 Artemisia annua leaf cDNA library Artemisia annua cDNA clone PY-2 3', mRNA sequence

DNA Sequence

CATTGCCATAGAGACCGCTAGTGCACTAATGTATCTTTCATGCCAATGAAATCATACATAGAGACGTAAAGACTAGTAACATTCTTCTTGACCACAATTTTTGTGTCAAGGTAGCAGATTTTGGTCTATCAAGGCTCATGCCAAATAACGCTAATCATGTGTCATCAGCTCCACAGGGAACCCCAGGTTACCTGGACCCTCAATATCACCAAAGTTATCAGTTAACAGATAAGAGTGATGTTTACAGCTTTGGAGTGGTCCTGGTAGAACTGATATCATCCATGACAGCTGTCGATTTGAATAGGTGTCAAGATGAGATAAGTCTGGCTAACCTTGCTTTGAACAGAATCCAAAAATGTGAACTTGATCAATTGATTGACCAGGCTTTAGTATCTGTTTCAAAAGGTGAAATGATGGCAATGATGACATCAGTAGCAGAGTTGGCCTTTAGATGTTTACAGTATCATTCTGAAATGAGGCCTACGATGAGCGAAGTGTTAGATGTGTTGAGGGATATTCAAAGGGAAGGAAGAATAGATGATCATGACAGAATAGGAGACAAAGCACCACTTCTATCTGAAAACAATGATATGGTGCTTTTGTTGAAAGACTTTCCGCCTTCGCCGGTTTCCGTCAATGGCGAATGGCAAAGTGATACTATTGTATCAACTACAATAAGCTGCAATGGAGATGGTTTGCCAATGAATAATTCGACCAGTAAATAGAAACATTATGCAGATTTAGGTATAATGCGGGTGTATGTTCACATTTTTCATCGTTTTTTGTGCACTAAATCTGAAAGTTTCTTGATGAGGGAAAATGTGATGTAAATAACATATAGATTCAGTATCAATGTCTTCTGCTAATGAGCAGCTTTGAGTGTTaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Aan.44 translated coding region predicted by ESTScan from UniGene Aan.44

XIAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVLRDIQREGRIDDHDRIGDKAPLLSENNDMVLLLKDFPPSPVSVNGEWQSDTIVSTTISCNGDGLPMNNSTSK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-185 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XIAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVLRDIQREGRIDDHDRI

HMMSmart: SM00220
IPR002290
1-170 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XIAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVL

HMMSmart: SM00219
IPR020635
1-170 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XIAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVL

Gene3D: G3DSA:1.10.510.10
2-184 no description

IAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVLRDIQREGRIDDHDR

HMMPfam: PF00069
IPR017442
2-167 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVL

superfamily: SSF56112
IPR011009
2-170 Protein kinase-like (PK-like)
Protein kinase-like domain

IAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVL

HMMPanther: PTHR24420:SF426
2-229 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVLRDIQREGRIDDHDRIGDKAPLLSENNDMVLLLKDFPPSPVSVNGEWQSDTIVSTTISCN

HMMPanther: PTHR24420
2-229 FAMILY NOT NAMED,FAMILY NOT NAMED

IAIETASALMYLHANEIIHRDVKTSNILLDHNFCVKVADFGLSRLMPNNANHVSSAPQGTPGYLDPQYHQSYQLTDKSDVYSFGVVLVELISSMTAVDLNRCQDEISLANLALNRIQKCELDQLIDQALVSVSKGEMMAMMTSVAELAFRCLQYHSEMRPTMSEVLDVLRDIQREGRIDDHDRIGDKAPLLSENNDMVLLLKDFPPSPVSVNGEWQSDTIVSTTISCN

PatternScan: PS00108
IPR008271
18-30 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox