PRGDB00064722 (Aan.10357)

From PRG Wiki
Revision as of 13:04, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.10357
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159708989 (EY080826)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI1451.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI1451 5', mRNA sequence

DNA Sequence

CAAAACGCATATTAAACACACCACCTACCTCTCACTCCTTCTCTCTCAGAACTTGTTCTACTTCCAGTTCTTGTGACAAGTATTCCTTCAATTCACATCATTTTGTAACCCAAATCAAACGCCCtttttttttAGTCATGACTTCTCATGAATACACAGACATGATGGTTTCACCCGATGACTTTGCTCACCTTAAAATCCCCCTTCAAGATATACTATCAGCCACCGACAACTTTTCTGACAAATATATCTGCGGAAAAGATGCATATGAAACATATTACAAAGTACAGCTCTTGTGGTCTGGTGAGTTAATTAATATCTACGCTGGGAGGTTAAATAAAGAACGGTCTGATGGAGACCAACAGTTTTGGATGGAGGTTTCCATGCTTTCTAGTCTCAAGCACAAGAATCTAGTTTCTCTTGTTGGGTTTTGTGATGATAATGATGAGAAGGTCATCATTATCAGGCATGAGACCAGAGAAAGTCTTCAGTGGCATCTAAGTGACCCGAAGTTGTTGACATGGGTGCGAAGATTGGAGATATCAGTCGGTGTTGCGCAAGCATTGAGCTACATTCATCATGACGAGCCACGTGATTTTAGCGTAATACACCGCTACATATGCAGTGGATTGATTTATTTAAATGATGACTGGGAACCCAAGTTAGGTGATTTTATACATTCCATGAAGATCAAAGCATCTGAAAGACACAATTCTTTCAATACTGATAAGGTGTGGAGTACGGATGGGTATACAGACCCAACATATATAGAGACAAAAAGTGCGAACCACAAGTCTGATATGTAC


Protein sequences

Name Description Sequence
Aan.10357 translated coding region predicted by ESTScan from UniGene Aan.10357

MTSHEYTDMMVSPDDFAHLKIPLQDILSATDNFSDKYICGKDAYETYYKVQLLWSGELINIYAGRLNKERSDGDQQFWMEVSMLSSLKHKNLVSLVGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
20-95 no description

KIPLQDILSATDNFSDKYICGKDAYETYYKVQLLWSGELINIYAGRLNKERSDGDQQFWMEVSMLSSLKHKNLVSL

superfamily: SSF56112
IPR011009
22-223 Protein kinase-like (PK-like)
Protein kinase-like domain

PLQDILSATDNFSDKYICGKDAYETYYKVQLLWSGELINIYAGRLNKERSDGDQQFWMEVSMLSSLKHKNLVSLVGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY

HMMPanther: PTHR24420
23-223 FAMILY NOT NAMED,FAMILY NOT NAMED

LQDILSATDNFSDKYICGKDAYETYYKVQLLWSGELINIYAGRLNKERSDGDQQFWMEVSMLSSLKHKNLVSLVGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY

ProfileScan: PS50011
IPR000719
33-223 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDKYICGKDAYETYYKVQLLWSGELINIYAGRLNKERSDGDQQFWMEVSMLSSLKHKNLVSLVGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY

HMMPfam: PF00069
IPR017442
66-223 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LNKERSDGDQQFWMEVSMLSSLKHKNLVSLVGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY

Gene3D: G3DSA:1.10.510.10
96-223 no description

VGFCDDNDEKVIIIRHETRESLQWHLSDPKLLTWVRRLEISVGVAQALSYIHHDEPRDFSVIHRYICSGLIYLNDDWEPKLGDFIHSMKIKASERHNSFNTDKVWSTDGYTDPTYIETKSANHKSDMY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox