PRGDB00064724 (Aan.10452)

From PRG Wiki
Revision as of 13:04, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.10452
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159638706 (EY068551)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CATG1747.fwd CATG Artemisia annua, Tanzanian, from Sandeman Seeds, 2+kb Artemisia annua cDNA clone CATG1747 5', mRNA sequence

DNA Sequence

GCAACACAAACCCTTTTTGTGATTCATCCAAACTTCAAACAAATCATAATCTTTTAATTGCGAGTAGAGGAAATCAATCATGAGTTGCTTCGGTTGTTGTGGAGAAGATGATATGCACAAGTCGTATGATAACGGACCGTACATGACGAATAATGCAGCAGGAAATAATGCAGGTTATCGTGCCACTGAGGCTGCACCAAAGGACACACAGGCTGTAGCCATCCAACCTATTGCCGTCCCTGCTCTTCAGGTGGATGAGTTGAAAGAAATAACTGATAATTTTGGGACAAAGTCTTTAATTGGAGAGGGTTCATATGGACGAGTGTACCATGGTGTTTTGAGAAGTGGGCAGGCAGCAGCTATCAAAAAGTTAGACTCCAGTAAGCAACCAGACCAGGAATTTTTAGGCCAGGTTTCTATGGTATCAAGGCTTAAACATGATCATGTGGTTGGGCTACTCGGGTATTGTGTTGATGGTGGATTAAGAGTGCTTGCCTACGAGTATGCTTCCAACGGATCTCTTCATGATATTCTGCACGGTAAGTGTTAAGAGCTATTTGTTTGTGTATACACATATAAACTTACACTCATATAGTGCATACATACACACATACACTTGTTAGACCTGTTTTGGTACCTATAGCCTTGTGAAAATTAGATATTTGATTATATGAATGCANGAAGGA


Protein sequences

Name Description Sequence
Aan.10452 translated coding region predicted by ESTScan from UniGene Aan.10452

MSCFGCCGEDDMHKSYDNGPYMTNNAAGNNAGYRATEAAPKDTQAVAIQPIAVPALQVDELKEITDNFGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHGKC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
1-155 SUBFAMILY NOT NAMED

MSCFGCCGEDDMHKSYDNGPYMTNNAAGNNAGYRATEAAPKDTQAVAIQPIAVPALQVDELKEITDNFGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHGK

HMMPanther: PTHR24420
1-155 FAMILY NOT NAMED,FAMILY NOT NAMED

MSCFGCCGEDDMHKSYDNGPYMTNNAAGNNAGYRATEAAPKDTQAVAIQPIAVPALQVDELKEITDNFGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHGK

Seg: seg
24-32 seg

NNAAGNNAG

superfamily: SSF56112
IPR011009
40-155 Protein kinase-like (PK-like)
Protein kinase-like domain

PKDTQAVAIQPIAVPALQVDELKEITDNFGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHGK

Gene3D: G3DSA:3.30.200.20
52-143 no description

AVPALQVDELKEITDNFGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYA

ProfileScan: PS50011
IPR000719
68-156 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGTKSLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHGKC

HMMPfam: PF07714
IPR001245
72-154 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGEGSYGRVYHGVLRSGQAAAIKKLDSSKQPDQEFLGQVSMVSRLKHDHVVGLLGYCVDGGLRVLAYEYASNGSLHDILHG

PatternScan: PS00107
IPR017441
74-97 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYHGVLRSGQAAAIKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox