PRGDB00064738 (Aan.12479)

From PRG Wiki
Revision as of 13:04, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.12479
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159745427 (EY105752)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Artemisia annua

Comment?

CAZI4398.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI4398 5', mRNA sequence

DNA Sequence

ATGTTATATAAGACTAACAGGTCAACACTTCCACCCATCATGAATGCTGCAGAAATTTATACTATAAAGCAGCTCCCACAAAGGCAGACAGATGATCAGGATGCTTCTGCCATGTGGAGCATCAAGTCAGCTTACAGATTAACAAAAACCTGGCAAGGAGATCCATGTGATCCGCATGAATATGTTTGGGATGGTATCAGTTGCAGCTACAACGAAATCGGATCTCATAGGATCGTATACTTGAACTTGTCTACCAGCGGACTGGATGGACCAATAAATCCTGCATTAGCTAATCTCACTATGATACATACCCTGGATTTGTCAAACAATAATCTAACAGGAATTGTGCCCAGTTTTCTCTCTGGACTGATTTTCTTGAAGATTTTAAATTTGAAAGGAAACAATTTTAGCGGTCAGATTCCAGCAGAGCTCCTAGCAAAGTCAAACAAGGGATTATTGTCATTGAGTTTTGATGCCGAGCCTACCAGTCACAATGCAACCACTTGTGACACAAATCGTTGTAGAAGTAAGAAGGATGTTCACACGGTCATTGTTCCAGTAATAGCAACGGTTGCTTTCATCTTTATGATCGTGACTGCACTTACCGTGATATGGATGAttaagaagaaaaaagaaaatggcacaaggctcgaagtaagaaaaaaaTACACATATTCAGACGTACAACGCATCACAAACAACTTCAATCATGTTATTGAGAGAGGAGGATTTGGAACAGTTTACCGTGGAAATATCGATAATACACAAGTTGCTGTCAAGATGCTTTCAAAATCGTCGCTCCAAGGGGACAAAGAATTTCAGGCTGAGGCCCATCTACTCCTTAGTGTTCATCATAAAAACTTGACTTTGTTCATGG


Protein sequences

Name Description Sequence
Aan.12479 translated coding region predicted by ESTScan from UniGene Aan.12479

MLYKTNRSTLPPIMNAAEIYTIKQLPQRQTDDQDASAMWSIKSAYRLTKTWQGDPCDPHEYVWDGISCSYNEIGSHRIVYLNLSTSGLDGPINPALANLTMIHTLDLSNNNLTGIVPSFLSGLIFLKILNLKGNNFSGQIPAELLAKSNKGLLSLSFDAEPTSHNATTCDTNRCRSKKDVHTVIVPVIATVAFIFMIVTALTVIWMIKKKKENGTRLEVRKKYTYSDVQRITNNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLFMX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF417
7-291 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RSTLPPIMNAAEIYTIKQLPQRQTDDQDASAMWSIKSAYRLTKTWQGDPCDPHEYVWDGISCSYNEIGSHRIVYLNLSTSGLDGPINPALANLTMIHTLDLSNNNLTGIVPSFLSGLIFLKILNLKGNNFSGQIPAELLAKSNKGLLSLSFDAEPTSHNATTCDTNRCRSKKDVHTVIVPVIATVAFIFMIVTALTVIWMIKKKKENGTRLEVRKKYTYSDVQRITNNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLF

HMMPanther: PTHR24420
7-291 FAMILY NOT NAMED,FAMILY NOT NAMED

RSTLPPIMNAAEIYTIKQLPQRQTDDQDASAMWSIKSAYRLTKTWQGDPCDPHEYVWDGISCSYNEIGSHRIVYLNLSTSGLDGPINPALANLTMIHTLDLSNNNLTGIVPSFLSGLIFLKILNLKGNNFSGQIPAELLAKSNKGLLSLSFDAEPTSHNATTCDTNRCRSKKDVHTVIVPVIATVAFIFMIVTALTVIWMIKKKKENGTRLEVRKKYTYSDVQRITNNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLF

superfamily: SSF52058
28-144 L domain-like,LRR

RQTDDQDASAMWSIKSAYRLTKTWQGDPCDPHEYVWDGISCSYNEIGSHRIVYLNLSTSGLDGPINPALANLTMIHTLDLSNNNLTGIVPSFLSGLIFLKILNLKGNNFSGQIPAEL

Gene3D: G3DSA:3.80.10.10
55-156 no description

PCDPHEYVWDGISCSYNEIGSHRIVYLNLSTSGLDGPINPALANLTMIHTLDLSNNNLTGIVPSFLSGLIFLKILNLKGNNFSGQIPAELLAKSNKGLLSLS

HMMPfam: PF00560
IPR001611
103-122 LRR_1
Leucine-rich repeat

HTLDLSNNNLTGIVPSFLSG

HMMPfam: PF00560
IPR001611
126-145 LRR_1
Leucine-rich repeat

LKILNLKGNNFSGQIPAELL

superfamily: SSF56112
IPR011009
221-288 Protein kinase-like (PK-like)
Protein kinase-like domain

KKYTYSDVQRITNNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNL

Gene3D: G3DSA:3.30.200.20
221-291 no description

KKYTYSDVQRITNNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLF

ProfileScan: PS50011
IPR000719
233-293 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNFNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLFMX

HMMPfam: PF07714
IPR001245
235-291 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FNHVIERGGFGTVYRGNIDNTQVAVKMLSKSSLQGDKEFQAEAHLLLSVHHKNLTLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox