PRGDB00064943 (Aan.24662)

From PRG Wiki
Revision as of 12:59, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.24662
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159635771 (EY108767)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CAZI5922.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI5922 5', mRNA sequence

DNA Sequence

TTCAAGTTTACAACTCTCTTATTCTTTCACACACACAAAACCTTAACTGATCATCTTGTACTTTCAGTATTTCGATTTGGTTGTAATAGAACTACTAAGTTACTTTATTGCAGCAGCTAGCCTTATAGTGATATAACATAGAAGAAACTCTAAAAAAACATAACAGAATATATGACCGAGTCAACGGTGAAGGTTGTCTGCGTAACCGGTGGAAGTGGCTATATCGGCTCATGGCTCGTCAGCCTGCTTCTTGATCGAGGTTACACCGTCAATGCCACAGTCAAAGATCTCAAAGATGAGAATGAGACGAAGCATCTGGAAGCTTTAGAAGGTGCAGAAACACGCCTGCGTCTGTTTCAAATGGATTTACTCGATTACGACTCGATTGCTGCTGCAGTTAGTGGTGTTTCTGGTGTGTTTCACGTGGCTTCACCTTGCACCGTTGATGACGTTCACGATCCTGAGCAAGAGCTATTGGCACCCGCAGTCAAGGGAACAATTAACGTACTCACAGCAGCAAAGAAGCTGGGAGTTAAGCGTGTGGTTATTACTTCATCTGTTTCAGCTATTGCGCCTAGTCCTACATGGCCGTCTGATATCCCGAAGAGTGAGAATTGCTGGACTGATGTTGAGTATTGCGAGCAAAATGAGTTGTGGTATCCGCTCTCCAAAACAATAGCTGAGAAAGCCGCTTGAGATTTTGCTAAAGAGAAAGGTTTGGACATAGTTGCGGTGCACCCTGGATTAGTTATGGGTCCTATTCTTC


Protein sequences

Name Description Sequence
Aan.24662 translated coding region predicted by ESTScan from UniGene Aan.24662

MTESTVKVVCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGPILX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
1-198 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MTESTVKVVCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGPIL

HMMPanther: PTHR10366:SF9
1-198 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MTESTVKVVCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGPIL

superfamily: SSF51735
7-196 NAD(P)-binding Rossmann-fold domains

KVVCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGP

Gene3D: G3DSA:3.40.50.720
IPR016040
7-196 no description
NAD(P)-binding domain

KVVCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGP

HMMPfam: PF01370
IPR001509
9-196 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGSGYIGSWLVSLLLDRGYTVNATVKDLKDENETKHLEALEGAETRLRLFQMDLLDYDSIAAAVSGVSGVFHVASPCTVDDVHDPEQELLAPAVKGTINVLTAAKKLGVKRVVITSSVSAIAPSPTWPSDIPKSENCWTDVEYCEQNELWYPLSKTIAEKAAXDFAKEKGLDIVAVHPGLVMGP

Seg: seg
170-181 seg

AEKAAXDFAKEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox