PRGDB00064946 (Aan.24740)

From PRG Wiki
Revision as of 12:59, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.24740
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159781665 (EY109701)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CAZI6414.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI6414 5', mRNA sequence

DNA Sequence

TATTGTCAACCACAGAAACCAATCCTAGGAGACAGTAACTTCCACAAAGTACAAATGAAAACTCGACAATCACCAGATCAAAAGTTTTGCAGTAGTAGCAGTGCAGCAACATGAGTGGCGTCGGAAAGACAGTTTGTGTTACGGGAGCTTCAGGCTTTGTAGCTTCGAATCTCGTAAAGCTTTTGCTCCAGCAAGGATACTCCGTTAAAGCCTCCGTTCGCTCTCCTAATAATTTAACGAAGACAGAACATTTGCTAAAACTTGATGGAGCTAAGGAAAGGCTTCACCTATTTAAAGCGGACTTACTCGAAAATGGTTCCTTTGATGCTGTCATTGATGGCTGTGATGGTGTTTTCCATACCGCTTCTCCTTTCTTCAATACAGTCACAGATCCACAGAAAGAGTTGATTGAACCTGCAGTGAAAGGAACACTTAATGTCCTTGGTTCTTGTTCAAAAGCTTCATCGGTCAAAAGAGTTGTCGTGACTTCCTCCCTTGCTGCAGCTGTATATAACGCAAGGCCTAAGACCTCTGAAGTTGTAGTTGATGAAACATGGTTTTCTGATCCACAACTTTGTAAAGAAATGAAATGGTGGTATGCGCTATCAAAAACATTGGCTGAAGATGCTGCATGGAAGTTCGCAGAAGAAAAGGGGATGGACATAGTCACCATAAATCCAGCAATGGTTATCGGTCCTCTACTACAGTCAACTCTGAACACTAGTGCTGAAGAAATCGCACAACT


Protein sequences

Name Description Sequence
Aan.24740 translated coding region predicted by ESTScan from UniGene Aan.24740

YCQPQKPILGDSNFHKVQMKTRQSPDQKFCSSSSAATXSGVGKTVCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPLLQSTLNTSAEEIAQL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
27-249 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

QKFCSSSSAATXSGVGKTVCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPLLQSTLNTSAEEIAQL

HMMPanther: PTHR10366
27-249 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

QKFCSSSSAATXSGVGKTVCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPLLQSTLNTSAEEIAQL

Seg: seg
31-39 seg

SSSSAATXS

superfamily: SSF51735
42-249 NAD(P)-binding Rossmann-fold domains

GKTVCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPLLQSTLNTSAEEIAQL

Gene3D: G3DSA:3.40.50.720
IPR016040
43-238 no description
NAD(P)-binding domain

KTVCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPLLQST

HMMPfam: PF01370
IPR001509
45-234 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFVASNLVKLLLQQGYSVKASVRSPNNLTKTEHLLKLDGAKERLHLFKADLLENGSFDAVIDGCDGVFHTASPFFNTVTDPQKELIEPAVKGTLNVLGSCSKASSVKRVVVTSSLAAAVYNARPKTSEVVVDETWFSDPQLCKEMKWWYALSKTLAEDAAWKFAEEKGMDIVTINPAMVIGPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox