PRGDB00065343 (Aan.69974)

From PRG Wiki
Revision as of 12:49, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.69974
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259553559 (EZ166841)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig26247, mRNA sequence

DNA Sequence

CTCCCTCTCAAACACCGACAGGAGAATAAATAAGTCTTTCATCAACAAGACAAATGGCTACATTTGAGTTGTACCGTCGATCAACAATTGGAATGTGTTTGACCGACACTTTGGATGACATGGTGTCGACTGGGAAACTTCGCCCTGATCTTGCTATCCAAGTGCTTGTTCAGTTCGACAAGTCAATGGCTGAGGCTCTGGACACTAAAGTTAAGACCAAGGTGTCCATCAAGGGGCATTTGCACACCTACAGATTCTGTGACAACGTGTGGAC


Protein sequences

Name Description Sequence
Aan.69974 translated coding region predicted by ESTScan from UniGene Aan.69974

MATFELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEALDTKVKTKVSIKGHLHTYRFCDNVWT

Domains

Domain Start-End Description Sequence

BlastProDom: PD009224
IPR015872
1-50 Q7FPX2_ORYSA_Q7FPX2;
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEALD

HMMPanther: PTHR10966
IPR003194
1-74 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEALDTKVKTKVSIKGHLHTYRFCDNVWT

Gene3D: G3DSA:1.10.287.190
IPR015872
2-54 no description
Transcription initiation factor IIA, gamma subunit

ATFELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEALDTKVK

HMMPfam: PF02268
IPR015872
3-49 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

TFELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEAL

superfamily: SSF47396
IPR009083
4-54 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGMCLTDTLDDMVSTGKLRPDLAIQVLVQFDKSMAEALDTKVK

superfamily: SSF50784
IPR009088
52-74 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKTKVSIKGHLHTYRFCDNVWT

HMMPfam: PF02751
IPR015871
52-74 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKTKVSIKGHLHTYRFCDNVWT

Gene3D: G3DSA:2.30.18.10
IPR009088
55-74 no description
Transcription factor IIA, beta-barrel

TKVSIKGHLHTYRFCDNVWT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox