PRGDB00065563 (Aan.103565)

From PRG Wiki
Revision as of 12:44, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Aan.103565
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259581883 (EZ291226)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig17613.Mt mRNA sequence

DNA Sequence

CGAGGCTTCCATTCGCCATGTACTCAAGGACTAGAAGTAATTCTGGTCCTTTACTACAACATCCAAGAAGGCGGATAAGATTACGATGATGGACATTACTAACAAGCCGCACTTCACTCTCAAAGTTAGCCTTTGCTATATCAGAACATAAGGCTAGTCTCTTCACCGCAACAATGTCTCCATCCTCTACAACCCCCTTGTACACATCTCCAAACCCTCCTTCTCCAAGTTTATTATCTTCCCGAAAACCCTTTGTCGCTCTTTTGAGATCATTGAAACTATAACCCTTTGGG


Protein sequences

Name Description Sequence
Aan.103565 translated coding region predicted by ESTScan from UniGene Aan.103565

XPKGYSFNDLKRATKGFREDNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYMANGSLX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
3-98 Protein kinase-like (PK-like)
Protein kinase-like domain

KGYSFNDLKRATKGFREDNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYMANGSL

Gene3D: G3DSA:3.30.200.20
3-93 no description

KGYSFNDLKRATKGFREDNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYM

HMMPanther: PTHR24420
5-98 FAMILY NOT NAMED,FAMILY NOT NAMED

YSFNDLKRATKGFREDNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYMANGSL

ProfileScan: PS50011
IPR000719
17-99 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FREDNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYMANGSLX

HMMPfam: PF07714
IPR001245
20-98 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DNKLGEGGFGDVYKGVVEDGDIVAVKRLALCSDIAKANFESEVRLVSNVHHRNLIRLLGCCSKGPELLLVLEYMANGSL

PatternScan: PS00107
IPR017441
23-45 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGDVYKGVVEDGDIVAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox