PRGDB00065870 (At.2117)

From PRG Wiki
Revision as of 12:36, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.2117
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145341136 (NM_118334)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SRF8 (STRUBBELIG-RECEPTOR FAMILY 8); ATP binding

DNA Sequence

ATAACTCAGAGCAAGCTTGGaatcaatctctcaatctctcactctctcACTACCTATCCTTTTCTTTAATGGCGATGTCTCTAACTACTACTATCCCCAACACACACTGTTActcttcttcttcttctctgtcactgtctattctctcttTTGGACCTTTCATGGCTATGTTTCTCTGCAATGGAAGTCCAAGCTCGTGATCACCAACACCGACACGCTAATGGCTATTGGAGATAGAGCTATGTTTACTGTTTTGCTTCTATTCATTGCTTCGATCTCTGGATTCTCTGTTGTTCGTTGTGTTACTGATCCATCTGATGTTCAAGCCCTTCAAGTTTTGTATACTTCACTAAATAGTCCTTCACAGCTAACCAATTGGAAAAATGGTGGTGGTGATCCATGTGGAGAGTCATGGAAAGGGATTACTTGTGAGGGCTCTGCAGTTGTCACTATAGATATATCGGATTTAGGAGTCTCTGGCACTCTTGGATACTTGCTCTCAGACCTTAAGTCACTCAGAAAATTGGATGTTAGTGGTAACAGCATCCATGATACACTTCCATATCAGTTGCCACCGAATCTCACAAGCCTAAATCTTGCGAGAAACAACCTAAGTGGTAACCTTCCATACTCCATATCCGCCATGGGTTCTCTTTCGTATATGAATGTAAGTGGTAATTCACTTACAATGTCAATAGGAGATATCTTTGCTGATCATAAGTCACTGGCAACCTTGGACCTTTCTCATAACAACTTCAGTGGCGATCTTCCTAGTTCCTTAAGCACAGTGTCCACACTTTCCGTTCTTTATGTTCAGAACAATCAATTGACAGGTTCCATCGATGTTCTCTCGGGGTTGCCTTTGAAAACTTTAAATGTTGCAAACAATCATTTCAATGGATCCATACCTAAGGAGCTTAGTTCTATTCAGACCTTAATATATGATGGTAATTCCTTTGATAACGTCCCTGCCTCTCCTCAGCCAGAAAGACCTGGCAAAAAAGAGACACCTTCTGGTTCTAAGAAACCCAAAATTGGTTCTGAAGAGAAATCTTCAGACTCTGGCAAGGGTTTGTCTGGTGGAGTAGTCACTGGTATAGTGTTCGGTTCTCTATTTGTTGCTGGTATTATAGCACTTGTTCTTTACTTGTGCCTTCACAAGAAAAAACGGAAAGTTAGAGGAAGTACAAGAGCTTCCCAAAGAAGTCTTCCGCTTAGTGGAACACCTGAGGTGCAGGAGCAGAGGGTAAAAAGTGTAGCATCCGTTGCAGACTTGAAGTCTTCACCTGCAGAAAAAGTAACGGTTGATCGCGTTATGAAGAACGGCTCTATAAGTAGAATAAGATCTCCTATCACTGCTTCACAATACACTGTTTCCTCTCTGCAAGTTGCAACAAACAGCTTTAGTCAAGAAAACATCATTGGTGAAGGTTCTCTAGGCCGTGTCTATAGAGCAGAGTTCCCCAATGGAAAGATAATGGCGATTAAGAAGATTGATAATGCAGCACTTTCATTACAAGAAGAAGATAATTTCTTAGAAGCCGTTTCAAATATGTCGCGGTTGAGGCATCCAAACATTGTTCCCTTGGCTGGATACTGCACCGAGCATGGTCAACGTCTTCTAGTGTATGAATATGTAGGAAATGGGAATCTAGATGATACGCTTCACACGAATGATGATAGAAGCATGAATCTGACTTGGAATGCGCGTGTTAAAGTGGCTCTTGGAACTGCCAAGGCTTTAGAGTACTTGCACGAAGTTTGCTTGCCTTCAATTGTCCATAGAAACTTCAAATCAGCGAATATATTGCTAGACGAAGAACTTAATCCTCACCTATCAGACAGTGGTTTAGCTGCTTTGACACCTAACACTGAGAGACAGGTTTCAACTCAAGTGGTAGGTTCATTTGGATACAGCGCTCCAGAGTTTGCACTGTCGGGAATTTACACAGTGAAAAGTGATGTATACACTTTTGGAGTAGTCATGCTTGAGCTCTTAACTGGTCGGAAGCCTCTTGACAGCTCGAGGACGAGAGCAGAGCAATCACTAGTGAGATGGGCAACACCGCAGCTTCACGATATAGATGCTTTGTCTAAAATGGTTGATCCTTCTCTTAATGGCATGTATCCAGCTAAGTCACTGTCTCGTTTTGCGGACATCATTGCTCTCTGTATTCAGCCGGAACCAGAGTTCAGGCCTCCAATGTCAGAGGTGGTGCAACAGCTAGTAAGATTAGTTCAAAGGGCAAGTGTTGTCAAACGAAGATCAAGTGATGACACTGGATTTTCATACAGGACACCTGAACACGAGCACGTCGATATCTCATTCTGAGTAATGATCCAAAACTACTCCAAAATCGGGTCTTTTCTGTCATTCGAAGCTAAAATGCAGCTTGAAAACTCAAAAGGAAGAGAGAGTTTTGCTCAATGCATAAGAGAATCTGATCCAAAGGACTACAGAGAAGTAAAGAAGCATCTTGGTTCATACCAAAAGTGTAAGAAAATATATGTTTGTGTATTTTTGTAAGAGTAAAATTAGAGTACATAACCATGTTTCAATCATCTTTCTTGTACCATTTTCTCTTCACCTGTTGAATAATCAAGTATGAGACTTGTTGCTGCATCAAAATAACATTTGAAATTTTGCCTATTTAAGAGCTCTTCTTTGTTGTTG


Protein sequences

Name Description Sequence
At.2117 translated coding region predicted by ESTScan from UniGene At.2117

MAIGDRAMFTVLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDNVPASPQPERPGKKETPSGSKKPKIGSEEKSSDSGKGLSGGVVTGIVFGSLFVAGIIALVLYLCLHKKKRKVRGSTRASQRSLPLSGTPEVQEQRVKSVASVADLKSSPAEKVTVDRVMKNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHEHVDISF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF891
1-703 SRF8 (STRUBBELIG-RECEPTOR FAMILY 8); KINASE

MAIGDRAMFTVLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDNVPASPQPERPGKKETPSGSKKPKIGSEEKSSDSGKGLSGGVVTGIVFGSLFVAGIIALVLYLCLHKKKRKVRGSTRASQRSLPLSGTPEVQEQRVKSVASVADLKSSPAEKVTVDRVMKNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHEHVDISF

HMMPanther: PTHR24420
1-703 FAMILY NOT NAMED,FAMILY NOT NAMED

MAIGDRAMFTVLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDNVPASPQPERPGKKETPSGSKKPKIGSEEKSSDSGKGLSGGVVTGIVFGSLFVAGIIALVLYLCLHKKKRKVRGSTRASQRSLPLSGTPEVQEQRVKSVASVADLKSSPAEKVTVDRVMKNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHEHVDISF

superfamily: SSF52058
27-251 L domain-like,LRR

CVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDNVPA

HMMPfam: PF08263
IPR013210
31-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITC

Gene3D: G3DSA:3.80.10.10
32-274 no description

SDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDNVPASPQPERPGKKETPSGSKKPKIGS

Seg: seg
92-103 seg

LLSDLKSLRKLD

HMMPfam: PF13504
98-114 LRR_7,Leucine rich repeat

SLRKLDVSGNSIHDTLP

HMMPfam: PF13855
119-179 LRR_8,Leucine rich repeat

PNLTSLNLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNF

Seg: seg
185-196 seg

SSLSTVSTLSVL

Seg: seg
273-288 seg

GSEEKSSDSGKGLSGG

superfamily: SSF56112
IPR011009
367-692 Protein kinase-like (PK-like)
Protein kinase-like domain

KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYR

Gene3D: G3DSA:3.30.200.20
378-458 no description

ITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAG

ProfileScan: PS50011
IPR000719
395-672 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRL

HMMSmart: SM00219
IPR020635
395-669 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQL

HMMSmart: SM00220
IPR002290
395-670 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLV

HMMPfam: PF00069
IPR017442
397-668 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQ

Gene3D: G3DSA:1.10.510.10
459-669 no description

YCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQL

Seg: seg
665-679 seg

VVQQLVRLVQRASVV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox