PRGDB00065912 (At.9206)

From PRG Wiki
Revision as of 12:35, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.9206
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42458075 (BX831968)
Gene Class Mlo-like
Domain Type MLO
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Full-length cDNA Complete sequence from clone GSLTPGH42ZE05 of Hormone Treated Callus of strain col-0 of Arabidopsis thaliana (thale cress)

DNA Sequence

TTTCGAAAAGAGACATGGAGGAGTGTTATTAGGTTGATTGTTCTCAAGTACCTCCAGTGTCAAACAAACATTGACGATTGATTCTCTTCCCATAATTTATTGTTATGCATTACATATCACAGTAAACGGACTTTCAGTCAACACCGCATTTATTTGCCCTCTTCATTGTTTCACGTACGTAATCAAGGACCAAGGGATTTTCTTCTTTTGGCTACCATGGCCACAAGATGCTTTTGGTGTTGGACCACTTTGCTCTTCTGCTCTCAGCTGCTTACCGGCTTTGCCCGAGCTTCCTCTGCAGGCGGCGCCAAAGAGAAAGGACTCTCCCAAACTCCCACCTGGGCCGTTGCCCTCGTCTGTACCTTCTTCATTCTTGTCTCCGTCCTCCTCGAGAAGGCTCTTCACAGAGTTGCCACGTGGTTGTGGGAGAAACATAAGAACTCTCTGCTTGAAGCCTTGGAGAAAATAAAGGCGGAGCTGATGATTCTAGGATTCATTTCCTTGTTGCTCACCTTCGGAGAGCAGTACATTCTCAAGATTTGTATTCCTGAAAAGGCTGCAGCCTCTATGTTACCTTGTCCAGCTCCTTCTACTCATGACCAAGACAAGACCCACCGCAGACGTCTAGCTGCTGCTACGACCTCTTCCCGCTGCGATGAGGGTCATGAACCACTCATACCTGCCACGGGTTTGCACCAGCTACACATTCTATTGTTCTTCATGGCTGCCTTTCATATCCTCTACAGTTTCATCACCATGATGCTTGGCAGACTCAAGATCCGTGGCTGGAAAAAGTGGGAGCAGGAGACATGTTCTCATGATTACGAGTTTTCAATCGATCCATCAAGATTCAGACTCACTCATGAGACGTCCTTTGTTAGACAACATTCCAGTTTCTGGACAAAAATCCCCTTCTTCTTTTATGCTGGGTGCTTCCTACAGCAGTTTTTCCGATCTGTAGGGAGGACTGACTACTTAACTCTGCGTCAATGGCTTCATCGCTGTAAGGCAAAACTCAATTTTCTCTTGTATTTGCCTTCCACTAATGGTGTGATGCTTATGGGTGAGTCTCCTTTAGGCCCATTTTAGCTCCAGGAAGAAAGTTCGACTTCCAGAAGTATATCAAAAAGATCATTGGAAGACGATTTCAAGGTGGTAGTTGGAATAAGTCCTCTTTTGTGGGCATCATTTGTAATTTTCCTACTTCTGAATGTTAATGGCTGGGAAGCATTGTTTTGGGCGTCAATCCTACCTGTACTTATCATTCTAGCTGTCAGTACGAAGCTTCAAGCGATCCTAACAAGAATGGCTCTGGGAATCACGGAGAGACACGCAGTTGTTCAAGGGATACCTCTCGTGCATGGTTCAGATAAGTACTTTTGGTTTAATCGCCCTCAGTTGCTACTTCATCTTCTTCACTTCGCCTTATTTCAGAATGCTTTCCAGCTAACATACTTCTTCTGGGTCTGGTATTCCTTTGGGCTAAAATCTTGCTTTCACACGGATTTCAAACTAGTCATCGTAAAACTCTCTCTAGGCGTTGGAGCTTTGATTTTGTGCAGCTACATCACACTTCCTTTGTATGCACTAGTTACTCAGATGGGTTCAAACATGAAGAAAGCTGTGTTTGATGAGCAAATGGCAAAAGCGTTGAAGAAATGGCACATGACTGTGAAGAAGAAGAAAGGCAAAGCGAGAAAGCCACCAACAGAGACCCTTGGTGTTTCTGACACTGTCAGCACCTCTACCTCATCCTTTCACGCCTCTGGAGCCACTCTACTCCGCTCCAAGACCACTGGTCACTCGACAGCCTCTTATATGAGTAATTTCGAGGACCAAAGCATGTCTGATCTTGAAGCTGAGCCATTATCCCCTGAACCAATAGAGGGGCACACTCTCGTCAGGGTTGGTGATCAGAACACAGAGATAGAATATACTGGAGATATTAGTCCTGGAAACCAATTCTCCTTTGTGAAGAACGTTCATAGCTAATGATATTGACTAATATTCAAAATGAATGCAGAACAAATCCATCATCCGTCTTTA


Protein sequences

Name Description Sequence
At.9206 translated coding region predicted by ESTScan from UniGene At.9206

MATRCFWCWTTLLFCSQLLTGFARASSAGGAKEKGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGFISLLLTFGEQYILKICIPEKAAASMLPCPAPSTHDQDKTHRRRLAAATTSSRCDEGHEPLIPATGLHQLHILLFFMAAFHILYSFITMMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFFYAGCFLQQFFRSVGRTDYLTLRQWLHRCKAKLNFLLYLPSTNGVMLMGESPLGPFXLQEESSTSRSISKRSLEDDFKVVVGISPLLWASFVIFLLLNVNGWEALFWASILPVLIILAVSTKLQAILTRMALGITERHAVVQGIPLVHGSDKYFWFNRPQLLLHLLHFALFQNAFQLTYFFWVWYSFGLKSCFHTDFKLVIVKLSLGVGALILCSYITLPLYALVTQMGSNMKKAVFDEQMAKALKKWHMTVKKKKGKARKPPTETLGVSDTVSTSTSSFHASGATLLRSKTTGHSTASYMSNFEDQSMSDLEAEPLSPEPIEGHTLVRVGDQNTEIEYTGDISPGNQFSFVKNVHS

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
32-272 Mlo
Mlo-related protein

KEKGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGFISLLLTFGEQYILKICIPEKAAASMLPCPAPSTHDQDKTHRRRLAAATTSSRCDEGHEPLIPATGLHQLHILLFFMAAFHILYSFITMMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFFYAGCFLQQFFRSVGRTDYLTLRQWLHRCKAKLNFLLY

Seg: seg
77-88 seg

LLEALEKIKAEL

Seg: seg
132-142 seg

THRRRLAAATT

Seg: seg
296-306 seg

SSTSRSISKRS

HMMPfam: PF03094
IPR004326
304-513 Mlo
Mlo-related protein

KRSLEDDFKVVVGISPLLWASFVIFLLLNVNGWEALFWASILPVLIILAVSTKLQAILTRMALGITERHAVVQGIPLVHGSDKYFWFNRPQLLLHLLHFALFQNAFQLTYFFWVWYSFGLKSCFHTDFKLVIVKLSLGVGALILCSYITLPLYALVTQMGSNMKKAVFDEQMAKALKKWHMTVKKKKGKARKPPTETLGVSDTVSTSTSS

Seg: seg
394-411 seg

QLLLHLLHFALFQNAFQL

Seg: seg
487-495 seg

KKKKGKARK

Seg: seg
503-513 seg

VSDTVSTSTSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox