PRGDB00065914 (At.9551)

From PRG Wiki
Revision as of 12:35, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.9551
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145359620 (NM_125790)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G63940) mRNA, complete cds

DNA Sequence

GGAGACAGTTAACGTGATTCGCCCTTTTCTCTTTGCCCAAGAGCTATACGACAATACCTccaccacaccccacacacacacacgagagacagagagagagagagagGAAATTTGCTACTGAGAGATACATTCAGTGAGTGTGTGTCTGTCACCGTGGAGGAGAAACGGAAGGAGGATAGATGAAACCGACCGGAGAAGGAGGAGGGGAAGTCGCCGGAGCGGTGGCGGAAGGTTCGGCGTTGTTAATTGTAGGAGTAAAGCCAGATGAATGGAGTAGAGAGGTTCTTACATGGTCTTTGGTGAATGTAGCGCGTCCTGGAGATCGAATCGTTGCTCTTCATGTTCTCGATTATTCTCTAGAGGGCTCAACGTCGCTTATTTCGTTGGTTAGGAATTTTGATACTATGCTTGGTGTTTATGAAAGCTTCTGCAACTTAAAACAGGTAGATTTGAAGTTGAAGGTTTTCAGAGGGAAGTCAGCTAGGAAAGTTCTTGTACAAGAAGTTAAATCGTGTGGAGCTACAAGTTTAATCGTTGGTTCCTCTAGGAAACATCACACTATCCGTTCTTCAGCTTCTTTAGCCAAGTATTGTGCCAGGAATCTTGCCAAGGATGTCTCTGTTTTTGCTGTTAAAAGTGGCAAGATTATGTTCCGCAGAGTACCTAATACCAATGGTGCAGATGGTCCACAGATGAATATTCCCTCTTTAGTTTGTGGATCACCAGATATTGCTATTGAAGCGGCAAAGATTGGAAACAGTTTTAGCCCTGCTAGAACGAGCTCACGCTGGACAAGAACTAGTCGTAGTTCGTCATTGCAGTCTCCTGACAGCTTAGGTGTAGACAATTTGTTGGCTTTAGTGCCAGTACAAACAAATGAGACTGATTCTGGTTCCCTTGAGTCAGGACCAGGTTGGCATTTTCTTCGCGGGCTTTACGGTAATAATCGAAAAAGCTGGACCAAAGTTTCTGCTAAGAAGGCTGTACTTCAGTGGGTTTCGAGGCTGCGAGGTCGGCATTCAGAAACTGTAATCTATCTGGATAGGAAACGGAGTGACTCTGGTTGTGATGAAGATTGCTCTTCTAGTATTGATGGTGAAGATGTTTCTATATCACGGTTTGGTTCTGAGCTTATGCAGTCACCTCTTTCTCCTTTCATTGGATCAAACAACATTCCAGAAGAGCTGGAAGGTCTACATGAAAAGTACTCTTCCACATGTAGATTATTCACATACGAGGAAGTCTTGTCAATTACCTCAAACTTTGCATCTGAGAACTTGGTTGGAGAAGGTGGTAATAGTTATGTTTATAGAGGAGATCTACCAGATGGCAGGGAATTAGCTGTCAAAATATTGAAACCTTGTCTGGATGTGTTGAAGGAATTTATACTGGAAATTGAAGTCATTACCAGTGTACATCACAAAAATATAGTATCTCTCTTTGGTTTCTGTTTCGAGAATAATAATTTGATGCTGGTATACGATTATCTACCACGAGGAAGCCTTGAAGAGAACCTTCATGGCAATAGAAAGGATGCAAAGAAATTTGGCTGGATGGAGAGATATAAGGTGGCAGTGGGTGTTGCCGAGGCGTTAGACTATCTGCATAATACTCATGATCCAGAAGTAATTCACCGGGATGTCAAATCTTCTAATGTTCTTTTGGCAGATGATTTTGAGCCACAGCTCTCAGATTTCGGATTCGCCAGCTTGGCTTCAAGTACCTCACAGCATGTAGCGGGTGGGGATATTGCCGGGACATTTGGTTACCTAGCACCAGAGTACTTCATGCACGGTAAAGTAACCGACAAGATTGATGTCTATGCTTTTGGTGTTGTATTGCTCGAGCTCATATCGGGTAGAAAACCAATCTGCGTCGACCAGTCTAAAGGCCAGGAGAGCCTTGTCTTGTGGGCAAACCCAATTCTAGATAGTGGAAAGTTTGCTCAGTTACTGGATCCCAGTCTAGAAAATGATAACAGTAACGATCTAATCGAGAAACTATTGTTAGCTGCCACGCTATGCATCAAACGCACACCTCATGACCGTCCGCAAATTGGCCTTGTCCTAAAGATATTACAAGGGGAAGAAGAAGCAACAGAGTGGGGAAAGCAACAAGTGAGAGCCTCAGAAGACGTGAGCGCATATTTGACAAATATAGAATCACACATAAACCTCGCATTGCTTGATTTGGAAGATGATGCAGCTTCTGATAGCAGCCCTGAAGCTAGTAGTATCTCTGTTGAGGAATACTTGAAAGGGCGATGGAGCCGCACTGCTAGCTTCAACTTCAACTAATAATTTTTACTAGTTTAACCCCGAAAATCCCAAAATTTGACGATATTGTAAGTTGTGTAAATTGTAATCGATTTTCTGAGATTCTCAAGCTTTAAGTTGTGTCAATTTAGGAAGAGTGAATAGCTCTTGTAGAGAGGACTTAAGTTGGAATTTGTCTTCTTTGTTTTGTCAGAGCAGAAAATGTTTCAAGTGTTCCACTTTCATATCGGTTTTAAAAGTTTAAAAATGT


Protein sequences

Name Description Sequence
At.9551 translated coding region predicted by ESTScan from UniGene At.9551

MKPTGEGGGEVAGAVAEGSALLIVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSVFAVKSGKIMFRRVPNTNGADGPQMNIPSLVCGSPDIAIEAAKIGNSFSPARTSSRWTRTSRSSSLQSPDSLGVDNLLALVPVQTNETDSGSLESGPGWHFLRGLYGNNRKSWTKVSAKKAVLQWVSRLRGRHSETVIYLDRKRSDSGCDEDCSSSIDGEDVSISRFGSELMQSPLSPFIGSNNIPEELEGLHEKYSSTCRLFTYEEVLSITSNFASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEATEWGKQQVRASEDVSAYLTNIESHINLALLDLEDDAASDSSPEASSISVEEYLKGRWSRTASFNFN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-694 PTHR24420,FAMILY NOT NAMED

MKPTGEGGGEVAGAVAEGSALLIVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSVFAVKSGKIMFRRVPNTNGADGPQMNIPSLVCGSPDIAIEAAKIGNSFSPARTSSRWTRTSRSSSLQSPDSLGVDNLLALVPVQTNETDSGSLESGPGWHFLRGLYGNNRKSWTKVSAKKAVLQWVSRLRGRHSETVIYLDRKRSDSGCDEDCSSSIDGEDVSISRFGSELMQSPLSPFIGSNNIPEELEGLHEKYSSTCRLFTYEEVLSITSNFASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEATEWGKQQVRASEDVSAYLTNIESHINLALLDLEDDAASDSSPEASSISVEEYLKG

HMMPanther: PTHR24420:SF425
1-694 PTHR24420:SF425,SUBFAMILY NOT NAMED

MKPTGEGGGEVAGAVAEGSALLIVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSVFAVKSGKIMFRRVPNTNGADGPQMNIPSLVCGSPDIAIEAAKIGNSFSPARTSSRWTRTSRSSSLQSPDSLGVDNLLALVPVQTNETDSGSLESGPGWHFLRGLYGNNRKSWTKVSAKKAVLQWVSRLRGRHSETVIYLDRKRSDSGCDEDCSSSIDGEDVSISRFGSELMQSPLSPFIGSNNIPEELEGLHEKYSSTCRLFTYEEVLSITSNFASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEATEWGKQQVRASEDVSAYLTNIESHINLALLDLEDDAASDSSPEASSISVEEYLKG

superfamily: SSF52402
22-152 SSF52402

LIVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSVFAVK

HMMPfam: PF00582
IPR006016
23-148 Usp
UspA

IVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSV

Gene3D: G3DSA:3.40.50.620
IPR014729
23-149 Rossmann-like_a/b/a_fold
Rossmann-like alpha/beta/alpha sandwich fold

IVGVKPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNLKQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDVSVF

superfamily: SSF56112
IPR011009
332-641 Kinase_like
Protein kinase-like domain

IPEELEGLHEKYSSTCRLFTYEEVLSITSNFASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEATE

Gene3D: G3DSA:3.30.200.20
342-436 G3DSA:3.30.200.20

KYSSTCRLFTYEEVLSITSNFASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDY

ProfileScan: PS50011
IPR000719
362-640 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FASENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEAT

HMMPfam: PF00069
IPR017442
365-577 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENLVGEGGNSYVYRGDLPDGRELAVKILKPCLDVLKEFILEIEVITSVHHKNIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVL

PatternScan: PS00107
IPR017441
368-390 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGGNSYVYRGDLPDGRELAVK

Gene3D: G3DSA:1.10.510.10
440-632 G3DSA:1.10.510.10

GSLEENLHGNRKDAKKFGWMERYKVAVGVAEALDYLHNTHDPEVIHRDVKSSNVLLADDFEPQLSDFGFASLASSTSQHVAGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWANPILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKI

PatternScan: PS00108
IPR008271
483-495 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox