PRGDB00065922 (At.10822)

From PRG Wiki
Revision as of 12:35, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.10822
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2465924 (AF024649)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana receptor-like serine

DNA Sequence

CAGAAACAGAGGATTCATCGATGTTATACTCTATCAAAAATTGCAGATTTGCATATGGAAAGACTTCTTCTTCACGATTCATGATCACACGTCGTCCGATTTCTGATGCAAATTTGTGCTTCGATCGCTCAATTCCTCGCTTGGGTTTCATTCCTTGTACTATTAGCGACGGTGGGCTCTTCTTCTTCTTCGGAATCTCTCCTAAATTGTCAACCTTTAGATCACCACCTTGTAAACCCTAGTCGTCTGCTTGGTTTCCTCAGAGCAATGTCTTCCGTCAATGATTTCATAACCAACGACAAGCTTTGGGTCGTTTCTTCCATCACCGATGTATCTCCACCTATCTATGTGTTTCTACAGTGCAGAGAAGATCTCTCTGTTTCCGATTGTCGACATTGCTTCAACGAGAGCAGATTGGAGCTCGAGAGAAATGTTCGGGTTCCGGTTGGTCGAATCCATAGTGATAGATGCTTCTTACGGTTTGATGATCGAGATTTCTCTGAGGAATTTGTTGATCCTACATTTGATAAAGCTAACTGTGAGGAAACAGGGACAGGGTTTGGAGAATTTTGGAGATTTCTTGATGAGGCTTTGGTGAATGTAACTTTAAAGGCTGTTAAAAATGGAGGGTTTGGTGCAGCTTCAGTGATTAAAACCGAGGCCGTGTATGCATTGGCTCAGTGTTGGCAAACACTTGATGAGAACACGTGTCGAGAGTGTTTGGTTAATGCTAGATCGAGCTTGAGAGCTTGTGATGGACATGAAGCTAGAGCTTTTTTTACTGGGTGTTACTTGAAGTATTCTACACACAAGTTCTTTGATGATGATGCTGCAGAACATAAACCTGACGCTGATCAGAGAAACTTTATAAGGTCATCGTTTTTTCCACATTTGAGTGATCGTGATGTTACGAGATTAGCAATTGCTGCGATTTCGTTGTCGATTCTTACTTCTCTTGGAGCCTTTATCAGTTACAGACGGGTTTCAAGGAAAAGAAAAGCTCAAGTTCCATCGTGTGTAAATTTCAAATACGAGATGCTTGAGAAAGCGACCGAGTCTTTCCATGACTCTATGAAACTAGGCCAAGGAGGGGCCGGTTCTGTATACAAAGGGATTCTTCCAGATGGCAGAATCGTTGCAGTCAAAAAGCTCTTCTTTAACACACGTGAATGGGCAGATCAATTCTTCAACGAAGTGAATCTGATCAGCGGAGTTCAACACAAGAACCTTGTGAGACTACTTGGTTGCAGCATTGAAGGTCCCAAAAGTCTTCTTGTCTATGAATATGTTCATAACAGAAGCCTTGATCAAATCCTTTTCATGAAGAACACAGTCCATATTTTGAGCTGGAAGCAACGGTTTAACATCATTATAGGAATATCAGAAGGTCTAGAATACCTTCACAGAGGATCTGAAGTAAAAATCATCCATAGAGACATCAAAACCAGCAATATTCTCCTTGATCGAAACCTAAGTCCCAAAATAGCTGATTTTGGACTCATACGTTCCATGGGCACTGACAAAACGCAAACCAATACTGGAATTGCTGGAACACTTGGTTATCTGGCTCCTGAATATCTGATCAAAGGCCAATTAACAGAGAAAGCTGACGTTTACGCATTTGGAGTTCTTATCATCGAGATAGTAACTGGCAAGAAAAATAACGCATTCACGCAAGGAACTAGCTCGGTTTTATACTCTGTATGGGAACATTTTAAAGCAAACACTTTAGATCGCTCTATCGATCCTCGGTTGAAAGGGAGTTTCGTAGAGGAAGAGGCCTTGAAGGTTCTTCAAATCGGATTGTTGTGTGTTCAATCTTCTGTAGAGTTGAGACCGTCGTCAATGTCTGAGATAGTCTTCATGTTACAGAACAAAGATAGTAAATTTGAATATCCGAAACAGCCTCCGTTCTTGAGTGCCAGTGTTCTAATGCCAGATGAGGAGACTAGAGTCTGATATTATCAGTTTCTTAGGATTGTTAATGTTCTTCTGTAAATGCTCAAAAATGGATTTTACACCATTTCTTTCTCCTTTTCAAATCTTTTATCGTTCATATTTTATTATGAAGGTCAACAAAAATGGAACCAAGGCTAGATTCTAAAAGTTTTGATTCGTTTACATCATTATTCATTTTACAATCTaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.10822 translated coding region predicted by ESTScan from UniGene At.10822

MSSVNDFITNDKLWVVSSITDVSPPIYVFLQCREDLSVSDCRHCFNESRLELERNVRVPVGRIHSDRCFLRFDDRDFSEEFVDPTFDKANCEETGTGFGEFWRFLDEALVNVTLKAVKNGGFGAASVIKTEAVYALAQCWQTLDENTCRECLVNARSSLRACDGHEARAFFTGCYLKYSTHKFFDDDAAEHKPDADQRNFIRSSFFPHLSDRDVTRLAIAAISLSILTSLGAFISYRRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASVLMPDEETRV

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
1-77 GNK2,Gnk2-homologous domain profile.

MSSVNDFITNDKLWVVSSITDVSPPIYVFLQCREDLSVSDCRHCFNESRLELERNVRVPVGRIHSDRCFLRFDDRDF

HMMPanther: PTHR24420:SF433
22-562 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VSPPIYVFLQCREDLSVSDCRHCFNESRLELERNVRVPVGRIHSDRCFLRFDDRDFSEEFVDPTFDKANCEETGTGFGEFWRFLDEALVNVTLKAVKNGGFGAASVIKTEAVYALAQCWQTLDENTCRECLVNARSSLRACDGHEARAFFTGCYLKYSTHKFFDDDAAEHKPDADQRNFIRSSFFPHLSDRDVTRLAIAAISLSILTSLGAFISYRRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASVLMPDEETR

HMMPfam: PF01657
IPR002902
22-77 Stress-antifung
Gnk2-homologous domain

VSPPIYVFLQCREDLSVSDCRHCFNESRLELERNVRVPVGRIHSDRCFLRFDDRDF

HMMPanther: PTHR24420
22-562 FAMILY NOT NAMED,FAMILY NOT NAMED

VSPPIYVFLQCREDLSVSDCRHCFNESRLELERNVRVPVGRIHSDRCFLRFDDRDFSEEFVDPTFDKANCEETGTGFGEFWRFLDEALVNVTLKAVKNGGFGAASVIKTEAVYALAQCWQTLDENTCRECLVNARSSLRACDGHEARAFFTGCYLKYSTHKFFDDDAAEHKPDADQRNFIRSSFFPHLSDRDVTRLAIAAISLSILTSLGAFISYRRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASVLMPDEETR

Seg: seg
66-77 seg

DRCFLRFDDRDF

ProfileScan: PS51473
83-183 GNK2,Gnk2-homologous domain profile.

DPTFDKANCEETGTGFGEFWRFLDEALVNVTLKAVKNGGFGAASVIKTEAVYALAQCWQTLDENTCRECLVNARSSLRACDGHEARAFFTGCYLKYSTHKF

HMMPfam: PF01657
IPR002902
101-183 Stress-antifung
Gnk2-homologous domain

FWRFLDEALVNVTLKAVKNGGFGAASVIKTEAVYALAQCWQTLDENTCRECLVNARSSLRACDGHEARAFFTGCYLKYSTHKF

Gene3D: G3DSA:2.60.120.200
IPR013320
196-282 no description
Concanavalin A-like lectin/glucanase, subgroup

DQRNFIRSSFFPHLSDRDVTRLAIAAISLSILTSLGAFISYRRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKG

superfamily: SSF56112
IPR011009
237-557 Protein kinase-like (PK-like)
Protein kinase-like domain

RRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASVLMP

ProfileScan: PS50011
IPR000719
265-563 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASVLMPDEETRV

HMMSmart: SM00220
IPR002290
265-550 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFL

HMMSmart: SM00219
IPR020635
265-534 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHDSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFML

HMMPfam: PF00069
IPR017442
267-470 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DSMKLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQ

Gene3D: G3DSA:3.30.200.20
283-327 no description

ILPDGRIVAVKKLFFNTREWADQFFNEVNLISGVQHKNLVRLLGC

Gene3D: G3DSA:1.10.510.10
328-532 no description

SIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVF

PatternScan: PS00108
IPR008271
386-398 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox