PRGDB00066019 (At.20885)

From PRG Wiki
Revision as of 12:32, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.20885
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339557 (NM_115463)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT3G56050) mRNA, complete cds

DNA Sequence

TTGTATCCTTCTTTAATTTATTATCGGGCCAAACCACGGGGACACGCGCTTTTAACAAAAGTTGAAAAGTCATGTTACTCCTCCTCTCAATTCGTCTCCTCCGCCATGCGAACTCAAACTCAAAGCTCTCTCTAACTTTTTGCTTTTCTTCGAATCTGTGATAGATCGAGACTTGGATTTATCAGCTTCTCCGTGCTCCTTTAGCTTCTGCTCGGttttgttttttttAGTCTGACGATGAGTAACAACTGGAAATCCGTTCGATTAAGGCTTCAAAATCGTACTCTCGTGTTTCTTCTGGTGATTTTGAGCTTCGGTTCTTGCTATTCGTTGAAATCTCAAGGTGATGGTTTTCTGGAATCCGTGACGAAAGATCTATGGTCAGATATAGATGCTGAGGATTTGAGAGCAGTTGGTTTTCACAGGAAATTACTTGGCCGTTTTCGTAACCCGTACACCCATTTGAATGCGTTCAGGGACCGCCCTGTGGCAAGAGCTACACCTCCGTCATCTTCGGTTTCTACGAGACCTGATGCCAAAAGATCCTCTACATTGCCTCCGCCACAAAAAAGTCCTCCTGCGCAACATGTTTCTGCTCCACCTCCTTTTGTGCACCATGTGACTTTACCTAGTCTAACAAGCAGCTCCAAAACTTCTTCAAACAGCACAATTCCTATAGTGGCTGGCTGCATAGCGGGTGCTGTGTTTATCCTCCTTTTAGCTACTGGTGTTTTCTTTTTTAAAAGTAAGGCTGGGAAATCTGTGAATCCCTGGCGTACAGGTCTTAGTGGACAACTTCAGAAAGTGTTCATAACTGGTGTCCCCAAACTCAAAAGATCTGAGATTGAAGCTGCCTGTGAAGATTTTAGTAATGTCATTGGGTCTTGCCCCATTGGTACATTGTTCAAAGGGACGCTATCAAGTGGGGTGGAGATAGCTGTGGCTTCTGTTGCTACTGCGTCTGCCAAAGAATGGACAAATAATATAGAAATGCAGTTCAGAAAGAAGATCGAAATGTTATCCAAGATAAACCACAAGAATTTTGTCAACCTTCTTGGTTACTGTGAAGAAGAAGAACCTTTCACTAGGATCTTGGTCTTTGAATATGCATCAAACGGAACAGTCTTTGAACATTTACACTATAAAGAATCAGAACACTTGGACTGGGTAATGCGGCTAAGAATAGCAATGGGCATAGCTTATTGCCTTGACCATATGCACGGACTCAAGCCACCTATAGTCCACAGCAATCTTCTCTCATCATCAGTTCAACTCACAGAGGACTACGCAGTCAAAATTGCGGATTTCAATTTTGGATATTTAAAAGGCCCATCCGAGACAGAAAGCAGCACCAATGCACTCATAGATACAAACATCTCAGAAACAACACAAGAAGACAATGTTCACAGCTTCGGGTTGCTGTTGTTTGAACTGATGACAGGAAAACTCCCAGAGTCAGTTCAAAAAGGTGACTCGATAGATACCGGATTGGCTGTCTTCTTGAGAGGAAAGACATTAAGGGAGATGGTGGATCCGACAATTGAAAGCTTTGACGAGAAGATTGAGAATATAGGTGAAGTGATCAAAAGCTGCATAAGAGCAGACGCGAAACAGAGACCGATAATGAAGGAAGTCACAGGGAGATTACGAGAGATCACTGGATTATCACCAGACGACACTATCCCAAAACTTTCACCACTCTGGTGGGCAGAGCTGGAAGTTCTGTCCACTGCGTGAAGAGACAACTACTGAACTTCACAAAAAAATCTGTAAGTATTAATATGAAGATTTGAGTGAGGTTTTTGAGTCTCTTAGAAGCTCTTGGCTTCTCTTTAGGCTACTTTCATCTATCTATCTATATATAAGTATGGAACTTAGTTTATATAACGGCTTTAAAATTCGGTGGATCTATTTGGTCGTTTATGTCGTAAACAGAAAATGTCCTAATCACGGTAATACCCCTTTTTGGTGTGCATAATGTTGGTGGGTGGTTACTGTCTTTGTAAATTAGTGTTACTATGTTCTTGATATGTTTAATCATCAGGTTCTGAAGTATAATTCACAAATTCTGCTCGTTCAAATTTATTTAGTTGAAGATGGTGCT


Protein sequences

Name Description Sequence
At.20885 translated coding region predicted by ESTScan from UniGene At.20885

MSNNWKSVRLRLQNRTLVFLLVILSFGSCYSLKSQGDGFLESVTKDLWSDIDAEDLRAVGFHRKLLGRFRNPYTHLNAFRDRPVARATPPSSSVSTRPDAKRSSTLPPPQKSPPAQHVSAPPPFVHHVTLPSLTSSSKTSSNSTIPIVAGCIAGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREITGLSPDDTIPKLSPLWWAELEVLSTA

Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-29 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MSNNWKSVRLRLQNRTLVFLLVILSFGSC

HMMPanther: PTHR24420:SF458
35-498 PTHR24420:SF458,SUBFAMILY NOT NAMED

QGDGFLESVTKDLWSDIDAEDLRAVGFHRKLLGRFRNPYTHLNAFRDRPVARATPPSSSVSTRPDAKRSSTLPPPQKSPPAQHVSAPPPFVHHVTLPSLTSSSKTSSNSTIPIVAGCIAGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREITGLSPDDTIPKLSPLWWAELEVLST

HMMPanther: PTHR24420
35-498 PTHR24420,FAMILY NOT NAMED

QGDGFLESVTKDLWSDIDAEDLRAVGFHRKLLGRFRNPYTHLNAFRDRPVARATPPSSSVSTRPDAKRSSTLPPPQKSPPAQHVSAPPPFVHHVTLPSLTSSSKTSSNSTIPIVAGCIAGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREITGLSPDDTIPKLSPLWWAELEVLST

Gene3D: G3DSA:3.30.200.20
196-283 G3DSA:3.30.200.20

PKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFT

superfamily: SSF56112
IPR011009
199-499 Kinase_like
Protein kinase-like domain

KRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREITGLSPDDTIPKLSPLWWAELEVLSTA

ProfileScan: PS50011
IPR000719
208-474 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREIT

HMMPfam: PF07714
IPR001245
210-469 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGR

Gene3D: G3DSA:1.10.510.10
284-466 G3DSA:1.10.510.10

RILVFEYASNGTVFEHLHYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFGYLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAVFLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox