PRGDB00066171 (At.27919)

From PRG Wiki
Revision as of 12:27, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.27919
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339962 (NM_116577)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SRF3 (STRUBBELIG-RECEPTOR FAMILY 3); ATP binding

DNA Sequence

TAATGAAGAACTTAAACTCTGTCTTAAACCCAAATAATTTCTGAATTTCTCCAGTTCTTTCTTCTTAATTTGCAGGTTTTGGTCCCACCGCTTAAATTAGGAAAAAGTTTCCTTTTTCGTTCTGGGTTTTCTTCTCTGATTATTATGATTCATTCCTCGAGTGTCGAGCTTTATTCTCAAGTGTCAAATTATTGAGGGTAAAATTTACTTCAACGACGAAAGTTCATTGAACCTTAGCTCTTACGTTGCGTCTTAAATCTCATTCTCACCCACaaaaaaagaaaagtttgcattttttttATCTCTCAGGATTGGGTTTTTGGGAATTTAAAGGAAAAGACTTTACCCTTTTATTCGTTTTAATTTCACCAACCCATTAAAGCTCGTTGATGACGATTCCTCTGCTTTTCCAATTCGTGGACATCGTTTTGTTCGATTGATGTTTCGTTTTACTCTACTCTGACTTGGAACAATGGCTGCTAAGAGATCTAtctactgtcttcttcttcttcctctgctcttgtctttactgatctggattccttcgatctccttAGCTGCTACTAACCCTGATGATGTTGCTGCAATTAACGGATTATTCGCTGCACTTGGAGCACCTGTTCTTCCTGGTTGGATTGCTTCTGGTGGAGACCCATGTGGTGAAGCTTGGCAAGGCATTATCTGCAATGTTTCAGATATTATAAGCATAACTGTAAATGCTGCAAATTTGCAAGGAGAGCTTGGTGACAACTTAGCTAAGTTCACTTCTATCAGGGGAATAGATTTCAGCAACAATCGCATTGGAGGAAGCATACCTTCTACTTTGCCGGTTACATTGCAGCATTTTTTTCTTTCAGCTAATCAGTTCACCGGAAGCATCCCGGAATCTCTAGGAACATTGAGTTTTCTGAATGACATGTCTTTGAACGATAACCTTCTCTCTGGAGAGCTACCCGACGTGTTTCAAAACCTTGTCGGGCTGATTAATCTTGATATATCATCTAACAATATAAGCGGCACATTGCCTCCTTCTATGGAGAATTTATTAACTCTTACAACATTACGTGTTCAGAACAATCAGCTCTCAGGAACTCTGGACGTTCTTCAAGGCCTTCCTCTTCAAGACTTAAACATAGAGAATAACCTCTTCTCTGGACCCATACCGGACAAATTACTAAGCATTCCGAAATTCCTACATGAAGGAAACCCGTTCAATGCCACAATGATCAATTCCACCTCGACTGCACCATCATTGTCTCCGTCTCTATCTCCAACAAAACCAGCTCCAACGCGACCATTTTCTGGAGTTCCACCTCCTCCAAATGAGAGGAATCGAGGGAAAGTTGCTGATGGACCTTCTGATTCAGAAGGATCGAGCTCTGAGAATTCAAAGGGAAAGAACTCTTCACATACTAAAAAGATAATCCTTATTGCATTCGCTGGCGTCCTCGTCTTCATAATTCTGGTTTTGGCAATACTCTTGCTGTTGCCAAAATGTGCAAGACGTAGAGAACATGCTAACAGAGTTTTCAAACCGCATCAAGTTGGTGCTGATAGAGGAAGCAGAGAGAATGCTCTGGAAAACGGGACTCCGGTACTGCCACCACCTGGTCGATCTGAAAAAGTTCAAAGAGAACCCTTCAAGAAAGCTGGAGAGGAACCAAAGGTCTTACATGACCTTGAGAGGCTGCGGAGACCTGCACCTATATCAAGACAGGAAAGTCAAGATATTGACTTTTCAATGTTGATgcctcctcctccaccacctccaccaccaccaccacctcctcctTTGGATGAGAAGGTCACGGTTATGCCAATCATATCACCCGAAAGACCCGTTAAGAAAACTTCCCCTAAACGCTTACCCTTAACTTCTGTGAAGCACTATTCTATTGCTTCTCTTCAACAATACACGGAAAGCTTCGCTCAGGAAAATCTCATTGGCTCAGGCATGCTCGGTAGTGTTTATAGGGCCCGGCTTCCCAATGGAAAGTTGTTTGCTGTCAAGAAGTTGGACAAGAGGGCTTCTGAACAACAACAGGATCACGAATTTATCGAACTAGTGAACAATATAGATATGATTCGCCACTCCAATATCGTTGAACTTGTGGGTTACTGTGCTGAGCACGATCAAAGACTATTGGTCTACGAATATTGCAGTAACGGTACGTTACAAGACGGGTTGCATTCAGACGATGAATTCAAGAAGAAACTTTCGTGGAATACCCGTGTCAGTATGGCACTTGGAGCTGCTAGAGCCCTTGAGTACTTGCATGAGGTGTGTGAACCACCTATCATACACAGAAACTTCAAATCAGCCAATGTTCTACTCGACGATGACCTGAGTGTTCTTGTCTCAGATTGTGGTTTGGCCCCACTAATATCATCAGGCTCTGTGAGTCAGTTATCAGGGCAATTGCTAGCCGCTTACGGATATGGAGCTCCAGAGTTCGACTCTGGAATCTATACATGGCAGAGTGATGTATATAGTTTTGGTGTTGTTATGTTAGAACTATTGACGGGTAGAATGTCCTACGATAGGGACCGGAGTAGAGGAGAGCAGTTCTTGGTGAGGTGGGCAATCCCACAGCTTCATGATATCGATGCATTGGGCAAAATGGTTGATCCATCTCTTAATGGACAATACCCTGCAAAGTCATTGTCACACTTTGCTGATATAATATCCCGGTGTGTTCAGTCTGAACCAGAATTTAGACCACTGATGTCAGAAGTTGTTCAAGATCTACTAGATATGATCAGAAGAGAGCGTCATGGTTCGGGTGATTCTACCGCGGACTAGTGAATTGTAAAGAAGCATTTTTTTATCGGATCATCTCTGTGAATTCGTGGAAACAAGAGATGTTCAGTTCTCAGAaacaacaacaacaacatagggaactaaaccagacacataaaaaaaaaaaaaaaaGCCAAAGCCTCAGAAGGAGGCTTAAGGAGGCTTAAGCTGATTCTACAGCCTTGTGAAGTGGCTCAGGGGAAAGGATCAATGTGCTTGCTTCCAATGGGCGATGATTCGATTGGTGCAGAGTTTCTTTTTGTGAATCTTGAATCATCTGTGTTAGTAATATGTATTGGTTGAAGACCTCTACTGTAAAATGGTGTGTTACTCGATTCTTTGAACTTGTTTTATTAAAACTTTAAAAGCTCATAGAACTTGCTCTGTGTTGTATTCTTTTAGTATGTGTGTGACTAAGTGTATTTGTGCCTGTAACATATTTATTTGTCT


Protein sequences

Name Description Sequence
At.27919 translated coding region predicted by ESTScan from UniGene At.27919

MAAKRSIYCLLLLPLLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGIICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKLLSIPKFLHEGNPFNATMINSTSTAPSLSPSLSPTKPAPTRPFSGVPPPPNERNRGKVADGPSDSEGSSSENSKGKNSSHTKKIILIAFAGVLVFIILVLAILLLLPKCARRREHANRVFKPHQVGADRGSRENALENGTPVLPPPGRSEKVQREPFKKAGEEPKVLHDLERLRRPAPISRQESQDIDFSMLMPPPPPPPPPPPPPPLDEKVTVMPIISPERPVKKTSPKRLPLTSVKHYSIASLQQYTESFAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDLLDMIRRERHGSGDSTAD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF890
1-767 SRF3 (STRUBBELIG-RECEPTOR FAMILY 3); ATP BINDING / KINASE/ PROTEIN SERINE/THREO

MAAKRSIYCLLLLPLLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGIICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKLLSIPKFLHEGNPFNATMINSTSTAPSLSPSLSPTKPAPTRPFSGVPPPPNERNRGKVADGPSDSEGSSSENSKGKNSSHTKKIILIAFAGVLVFIILVLAILLLLPKCARRREHANRVFKPHQVGADRGSRENALENGTPVLPPPGRSEKVQREPFKKAGEEPKVLHDLERLRRPAPISRQESQDIDFSMLMPPPPPPPPPPPPPPLDEKVTVMPIISPERPVKKTSPKRLPLTSVKHYSIASLQQYTESFAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDLLDMIRRER

HMMPanther: PTHR24420
1-767 FAMILY NOT NAMED,FAMILY NOT NAMED

MAAKRSIYCLLLLPLLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGIICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKLLSIPKFLHEGNPFNATMINSTSTAPSLSPSLSPTKPAPTRPFSGVPPPPNERNRGKVADGPSDSEGSSSENSKGKNSSHTKKIILIAFAGVLVFIILVLAILLLLPKCARRREHANRVFKPHQVGADRGSRENALENGTPVLPPPGRSEKVQREPFKKAGEEPKVLHDLERLRRPAPISRQESQDIDFSMLMPPPPPPPPPPPPPPLDEKVTVMPIISPERPVKKTSPKRLPLTSVKHYSIASLQQYTESFAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDLLDMIRRER

Seg: seg
10-28 seg

LLLLPLLLSLLIWIPSISL

superfamily: SSF52058
29-234 L domain-like,LRR

AATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGIICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKL

HMMPfam: PF08263
IPR013210
33-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGIICN

Gene3D: G3DSA:3.80.10.10
58-248 no description

GGDPCGEAWQGIICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKLLSIPKFLHEGNPFN

Seg: seg
143-157 seg

LSFLNDMSLNDNLLS

HMMPfam: PF00560
IPR001611
170-191 LRR_1
Leucine-rich repeat

LINLDISSNNISGTLPPSMENL

Seg: seg
254-273 seg

STSTAPSLSPSLSPTKPAPT

Seg: seg
298-312 seg

SEGSSSENSKGKNSS

Seg: seg
325-339 seg

VLVFIILVLAILLLL

Seg: seg
427-440 seg

PPPPPPPPPPPPPP

superfamily: SSF56112
IPR011009
455-759 Protein kinase-like (PK-like)
Protein kinase-like domain

RPVKKTSPKRLPLTSVKHYSIASLQQYTESFAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL

Gene3D: G3DSA:3.30.200.20
469-549 no description

SVKHYSIASLQQYTESFAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGY

ProfileScan: PS50011
IPR000719
485-763 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDLLDMI

HMMSmart: SM00220
IPR002290
485-763 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDLLDMI

HMMSmart: SM00219
IPR020635
485-759 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAQENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL

HMMPfam: PF07714
IPR001245
488-759 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENLIGSGMLGSVYRARLPNGKLFAVKKLDKRASEQQQDHEFIELVNNIDMIRHSNIVELVGYCAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL

Gene3D: G3DSA:1.10.510.10
550-759 no description

CAEHDQRLLVYEYCSNGTLQDGLHSDDEFKKKLSWNTRVSMALGAARALEYLHEVCEPPIIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFDSGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL

Seg: seg
619-631 seg

VLLDDDLSVLVSD

Seg: seg
637-651 seg

LISSGSVSQLSGQLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox