PRGDB00066270 (At.31176)

From PRG Wiki
Revision as of 12:24, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.31176
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358269 (NM_122055)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana EFR (EF-TU RECEPTOR); ATP binding

DNA Sequence

ATCTTTTTATAATCGACATGAAGCTGTCCTTTTCACTTGTTTTCAATGCTCTCACGTTGCTTCTTCAAGTTTGCATCTTTGCTCAAGCCAGGTTTTCTAATGAGACTGATATGCAAGCTTTGCTTGAGTTCAAGTCTCAAGTTTCTGAAAACAACAAGAGAGAGGTCTTGGCTTCATGGAATCACTCCTCCCCATTTTGTAATTGGATTGGAGTCACATGTGGCCGCAGGAGAGAAAGAGTTATAAGTTTGAACCTTGGAGGATTCAAGTTAACCGGTGTGATCTCACCCTCCATTGGTAATCTCTCCTTTCTTAGATTACTTAATCTTGCAGACAACTCTTTTGGAAGTACCATCCCTCAAAAGGTGGGAAGGCTATTTAGGCTTCAGTACTTGAACATGAGCTATAATCTTCTCGAAGGAAGGATTCCGTCTAGTCTTTCTAACTGCTCTAGACTGTCGACCGTTGATTTATCGTCAAACCATCTTGGACATGGTGTTCCTTCAGAACTAGGTTCACTTTCTAAGCTTGCCATTCTGGATCTTAGCAAAAACAACCTTACTGGAAATTTTCCTGCATCTTTAGGAAACTTGACGTCACTTCAGAAGCTTGACTTTGCATATAACCAGATGAGAGGTGAGATTCCAGACGAAGTAGCTAGATTGACTCAAATGGTGTTTTTCCAAATAGCACTGAATAGTTTTTCAGGTGGTTTTCCTCCTGCATTGTACAACATCTCCTCTCTTGAGTCTCTATCTCTAGCTGACAATAGCTTTTCGGGTAATCTTAGGGCTGATTTTGGTTATCTTCTACCAAATCTAAGAAGACTTCTTTTGGGAACAAATCAGTTCACTGGAGCTATTCCCAAAACACTTGCCAATATCTCAAGCCTTGAAAGGTTTGATATCTCATCTAATTACCTGTCTGGTAGTATCCCTTTGAGCTTTGGAAAGTTACGTAATCTGTGGTGGTTAGGGATTCGTAATAACTCTCTTGGAAATAACTCGTCCAGTGGTCTTGAATTTATTGGGGCTGTGGCGAACTGCACTCAATTAGAGTACTTAGATGTTGGTTACAATAGACTTGGAGGTGAGCTTCCTGCTTCTATAGCCAATCTGTCCACTACATTGACTAGTCTGTTCCTTGGACAAAATCTTATCTCTGGAACCATTCCTCATGACATCGGGAATCTTGTAAGCCTGCAAGAACTCAGCTTAGAAACAAATATGTTGAGTGGAGAACTTCCCGTCTCTTTCGGGAAGCTTTTGAACTTGCAGGTTGTGGATCTGTATTCAAATGCAATATCGGGGGAAATACCATCTTATTTTGGCAACATGACTCGGTTGCAGAAGCTCCATTTGAATAGCAATAGTTTCCACGGAAGAATCCCTCAGAGTCTTGGACGTTGTCGATACTTGCTAGACCTGTGGATGGATACAAATAGGTTGAATGGGACTATACCTCAGGAAATACTGCAAATTCCATCCCTCGCTTACATAGATTTGTCAAACAATTTCTTGACAGGCCATTTTCCAGAAGAAGTTGGAAAGTTAGAACTTCTTGTTGGACTAGGTGCTTCGTACAACAAATTATCAGGAAAGATGCCACAAGCTATAGGGGGTTGTCTTTCGATGGAATTTCTCTTTATGCAAGGAAATTCGTTTGACGGAGCCATTCCAGATATAAGCCGGTTGGTAAGCCTAAAGAATGTTGACTTCTCCAACAACAATCTCTCTGGCCGGATACCTCGATATCTGGCCAGTCTTCCTTCGCTGCGAAATCTGAATCTTTCTATGAACAAGTTTGAGGGAAGGGTGCCAACAACAGGAGTGTTTCGAAATGCTACAGCAGTTTCTGTTTTTGGTAACACAAATATTTGCGGAGGCGTCCGAGAAATGCAACTAAAGCCATGCATTGTACAGGCATCTCCAAGGAAGAGAAAGCCTCTGTCAGTTAGAAAGAAAGTTGTCAGTGGTATTTGTATAGGTATAGCTTCGCTTTTGTTAATCATAATTGTGGCTTCTCTGTGTTGGTTCATGAAGAGGAAAAAGAAAAACAATGCCAGTGATGGTAACCCATCTGATTCTACTACTTTGGGGATGTTCCATGAGAAGGTAAGTTATGAAGAGCTTCATAGTGCAACAAGTCGCTTCTCTTCAACCAATTTGATTGGTTCAGGCAATTTCGGTAATGTGTTTAAAGGATTGCTTGGCCCTGAGAATAAACTCGTCGCGGTTAAAGTTTTGAACCTCCTAAAGCATGGAGCGACGAAAAGCTTTATGGCGGAATGTGAAACCTTCAAGGGTATACGACATCGTAACCTTGTAAAACTGATAACGGTTTGTTCAAGCCTTGATTCCGAGGGAAATGATTTCAGAGCTCTGGTCTATGAGTTCATGCCAAAAGGAAGTCTGGATATGTGGCTGCAGCTAGAAGATCTGGAAAGGGTAAACGATCACTCGAGATCTTTAACACCCGCAGAGAAACTCAACATAGCAATAGATGTGGCTTCAGCTTTGGAGTATCTGCACGTTCATTGTCATGACCCTGTAGCTCACTGTGATATTAAGCCAAGCAACATTCTTCTAGACGATGATCTGACTGCTCATGTTAGTGACTTTGGTTTGGCTCAGCTCCTCTATAAATACGATCGAGAATCCTTTCTAAACCAGTTTAGTTCTGCTGGTGTCAGAGGCACCATTGGCTATGCCGCGCCAGAGTATGGAATGGGAGGCCAACCATCAATACAAGGAGATGTGTACAGCTTCGGAATTCTACTTTTGGAGATGTTTAGTGGAAAGAAACCAACAGATGAATCATTTGCAGGCGATTATAACCTCCACAGCTACACAAAGTCTATATTATCGGGTTGCACGAGCAGTGGAGGCAGCAACGCCATTGATGAGGGGTTGAGACTGGTTTTGCAGGTGGGGATAAAGTGTTCTGAAGAATATCCGAGGGATAGGATGAGAACGGATGAAGCAGTACGAGAATTAATCTCAATAAGATCTAAGTTCTTCAGTTCCAAGACGACTATTACAGAGAGTCCTCGAGATGCTCCGCAAAGTTCTCCTCAGGAATGGATGTTAAATACGGACATGCATACTATGTAGACCCTTCTCAACTACTTATGGGGACACAGTAAAAGTGTATTTGCGTGTGCATCATCGAAACAGAACAAATGTTGGGAGGAGGAGAGACTACTAGTTATAATAAGAGAATAAATTAAAATCTATCTCTGCTGTAGCCtttttttttttGTTGTGGGTGAAAATGATTATGATCACATATATATGGTCGTTGAATATCCTTTTTCATTTC


Protein sequences

Name Description Sequence
At.31176 translated coding region predicted by ESTScan from UniGene At.31176

XLFIIDMKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTITESPRDAPQSSPQEWMLNTDMHTM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-1003 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

XLFIIDMKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIR

HMMPanther: PTHR24420
1-1003 FAMILY NOT NAMED,FAMILY NOT NAMED

XLFIIDMKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIR

superfamily: SSF52058
31-330 L domain-like,LRR

RFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNN

HMMPfam: PF08263
IPR013210
35-74 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTC

Gene3D: G3DSA:3.80.10.10
35-330 no description

ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNN

HMMSmart: SM00369
IPR003591
102-126 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSFLRLLNLADNSFGSTIPQKVGRL

HMMPfam: PF00560
IPR001611
128-150 LRR_1
Leucine-rich repeat

RLQYLNMSYNLLEGRIPSSLSNC

HMMPfam: PF13855
151-210 LRR_8,Leucine rich repeat

SRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQ

HMMSmart: SM00369
IPR003591
174-197 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLAILDLSKNNLTGNFPASLGN

HMMSmart: SM00369
IPR003591
198-222 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLQKLDFAYNQMRGEIPDEVARL

Seg: seg
270-279 seg

LLPNLRRLLL

HMMSmart: SM00369
IPR003591
271-294 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLRRLLLGTNQFTGAIPKTLAN

HMMPfam: PF00560
IPR001611
297-319 LRR_1
Leucine-rich repeat

SLERFDISSNYLSGSIPLSFGKL

Seg: seg
329-340 seg

NNSLGNNSSSGL

superfamily: SSF52058
331-374 L domain-like,LRR

SLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLS

HMMPfam: PF13516
349-372 LRR_6,Leucine Rich repeat

CTQLEYLDVGYNRLGGELPASIAN

superfamily: SSF52058
375-628 L domain-like,LRR

TTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICG

Gene3D: G3DSA:3.80.10.10
375-627 no description

TTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNIC

HMMSmart: SM00369
IPR003591
398-421 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVSLQELSLETNMLSGELPVSFGK

HMMSmart: SM00369
IPR003591
422-445 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLQVVDLYSNAISGEIPSYFGN

HMMSmart: SM00369
IPR003591
446-470 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTRLQKLHLNSNSFHGRIPQSLGRC

HMMPfam: PF00560
IPR001611
496-517 LRR_1
Leucine-rich repeat

SLAYIDLSNNFLTGHFPEEVGK

Seg: seg
513-525 seg

EEVGKLELLVGLG

HMMSmart: SM00369
IPR003591
589-614 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPSLRNLNLSMNKFEGRVPTTGVFRN

Seg: seg
659-677 seg

GICIGIASLLLIIIVASLC

Gene3D: G3DSA:3.30.200.20
669-801 no description

LIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMP

superfamily: SSF56112
IPR011009
690-1022 Protein kinase-like (PK-like)
Protein kinase-like domain

DGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTITESPRDAPQ

ProfileScan: PS50011
IPR000719
718-1007 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFF

HMMSmart: SM00220
IPR002290
718-1007 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFF

HMMSmart: SM00219
IPR020635
718-999 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVREL

HMMPfam: PF00069
IPR017442
721-956 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILS

PatternScan: PS00107
IPR017441
724-747 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGNFGNVFKGLLGPENKLVAVK

Seg: seg
741-753 seg

NKLVAVKVLNLLK

Gene3D: G3DSA:1.10.510.10
817-1014 no description

VNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTIT

PatternScan: PS00108
IPR008271
851-863 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHCDIKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox