PRGDB00066554 (At.43792)

From PRG Wiki
Revision as of 12:16, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.43792
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358792 (NM_123668)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat transmembrane protein kinase, putative (AT5G43020) mRNA, complete cds

DNA Sequence

ATGCTTCTTCGATGTAACTTACCCATTTCTGGgtttcttctcttctgtttcctctttaccattgttgcttcttcttcttcttcCTCCAACCACACAAAGCGCGTGTTTCATTCTCACCGTGACGTTTCTGCTTTGTTACGTTTTAAATCCAAAGCTGATTTATGGAACAAGATAAACACGAGCTCTCATTTTTGTCAATGGTGGGGTGTTACGTGTTATGGAAACAGAGTTGTTCGTTTGGTTATTGAAGATCTTTATCTTGGAGGGCGACTCATTCCTGACTCAGTTAATAAACTCGACCAGCTTCGAGTTCTGAGTCTCAAGAACACTTCCTTAACCGGACCGTTACCAGATTTCTCCGGTTTGGTTAATCTCAAATCATTATTCCTCGATCACAACTCTTTTTCCGGTTCGTTTCCTCTCTCGGTTCTCGCTTTTCACCGGTTAAGAACTCTCGATTTCTCCTTCAATAACCTCACCGGTCCAATCCCATCCGGTTTAGTTCTCTCCGACCGGTTGATTTATCTCCGACTTGATTCGAATCGGTTCAACGGTCCCGTCCCGCCTTTAAACCAATCCACGCTTCATACATTCAATGTTTCGGTTAACAACTTAACCGGTGCTGTACCGGTGACAACCGTTCTGTTACGATTCGGTATTTCTTCATTTCTCAAAAACCCTAATCTCTGCGGTGAGATTGTTCACAAAGAATGCAATCCGAGAGCCAAATTCTTCACTCCGGTAACGGCGGCGCCGTCACCGAAGATGGTTCTCGGTCAAATAGCGCAAATAGGCGGCGCAAGATTATCCCGGCCAAGTCAAAACAAACATTCACGATTTTTTGTGATTCTCGGTTTTATCTCCGGCGCTTTTATCCTCTTCATCTCCGTCGCGTGCCTTATCGGCGCAGTGAAGAGACGAAGAAGCAAAACCGAGAAACAAAAGGGGAAAGAATCAACGGCGGTTGTGACATTTGACGCGGCGGAGACGGCGGAAGTAGCGGCGGCGATAGAACAAGAGAGTGAGATAGAAGAGAAAGTGAAGAAGCTACAAGCGACAAAAAGTGGGAGTTTAGTATTCTGTGCGGGTGAGGCACACGTTTATACGATGGACCAACTAATGACAGCATCAGCTGAGTTATTAGGTCGAGGAACAGTGGGGACCACTTATAAAGCGTTGCTTGATAGCCGTTTGATCGTCACGGTGAAGAGATTAGATGCCATTAGATTAGCGGGTGTAGGGAGAGACAAATTTGAGCATCACATGGAATCAGTTGGTGCTTTAGGGCATCCGAATTTGGTTCCACTCAGAGCTTATTTTCAGGCCAAGGAAGAGAGGTTATTGATTTATGATTATTTGCCAAATGGCAGTCTCTCGTCTCTTGTCCACGGTACAAAATCGTCGAGGGCAACGCCATTGCATTGGACATCTTGTTTGAAGATAGCAGAAGACGTCGCTCAGGGTCTCTCTTACATCCACCAAGCATGGCAGCTAGTTCACGGCAATCTCAAATCCTCTAATGTCCTTCTTGGACAAGACTTTGAAGCTTGTATTGCTGATTACTGTCTCGTTGCTCTTGCAACAAACCCTCCTCTAACATCCAATGACGGTCAAGAAGACGCGGATGCAGCAGCCTATAAACCCCCTGAAGCTCGACACAAGAGTCTAAATTATCAATCGGTTAAGGCTGATGTATACTCCTTTGGGATTCTTCTCTTGGAGCTTTTGACAGGGAAGCAACCTTCGAAGATTCCGGTTTTGCCTTTGGATGAGATGATCgaatgggtgaggaaagtgagagaggaaggtgagaagaagaatgggaattggagagaagaTAGGGATAAATTCGGAATGTTGACTGAAGTTGCGGTAGCTTGTAGCTTAGCATCGCCGGAACAGAGACCGACGATGTGGCAAGTGTTGAAAATGTTGCAAGAGATTAAAGAAGCGGCTGTGATGGAAGAGTGTGAACTTGTTATGGATTCTGCTAATTCTGAAAGCTCTTAATTAATTAAGGACAGTCATTTTATTTTTTCTTAACTAAATCTCTCTTCATGTCTCTCACTAATCTTAAAACTTTTATGTAACAGTGGCAGTTTTAGATTAGTGCCACGGTTCCTTAATCCTTACCCCGTTTTACTA


Protein sequences

Name Description Sequence
At.43792 translated coding region predicted by ESTScan from UniGene At.43792

MLLRCNLPISGFLLFCFLFTIVASSSSSSNHTKRVFHSHRDVSALLRFKSKADLWNKINTSSHFCQWWGVTCYGNRVVRLVIEDLYLGGRLIPDSVNKLDQLRVLSLKNTSLTGPLPDFSGLVNLKSLFLDHNSFSGSFPLSVLAFHRLRTLDFSFNNLTGPIPSGLVLSDRLIYLRLDSNRFNGPVPPLNQSTLHTFNVSVNNLTGAVPVTTVLLRFGISSFLKNPNLCGEIVHKECNPRAKFFTPVTAAPSPKMVLGQIAQIGGARLSRPSQNKHSRFFVILGFISGAFILFISVACLIGAVKRRRSKTEKQKGKESTAVVTFDAAETAEVAAAIEQESEIEEKVKKLQATKSGSLVFCAGEAHVYTMDQLMTASAELLGRGTVGTTYKALLDSRLIVTVKRLDAIRLAGVGRDKFEHHMESVGALGHPNLVPLRAYFQAKEERLLIYDYLPNGSLSSLVHGTKSSRATPLHWTSCLKIAEDVAQGLSYIHQAWQLVHGNLKSSNVLLGQDFEACIADYCLVALATNPPLTSNDGQEDADAAAYKPPEARHKSLNYQSVKADVYSFGILLLELLTGKQPSKIPVLPLDEMIEWVRKVREEGEKKNGNWREDRDKFGMLTEVAVACSLASPEQRPTMWQVLKMLQEIKEAAVMEECELVMDSANSESS

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
35-231 SSF52058,LRR

VFHSHRDVSALLRFKSKADLWNKINTSSHFCQWWGVTCYGNRVVRLVIEDLYLGGRLIPDSVNKLDQLRVLSLKNTSLTGPLPDFSGLVNLKSLFLDHNSFSGSFPLSVLAFHRLRTLDFSFNNLTGPIPSGLVLSDRLIYLRLDSNRFNGPVPPLNQSTLHTFNVSVNNLTGAVPVTTVLLRFGISSFLKNPNLCG

Gene3D: G3DSA:3.80.10.10
53-210 G3DSA:3.80.10.10

DLWNKINTSSHFCQWWGVTCYGNRVVRLVIEDLYLGGRLIPDSVNKLDQLRVLSLKNTSLTGPLPDFSGLVNLKSLFLDHNSFSGSFPLSVLAFHRLRTLDFSFNNLTGPIPSGLVLSDRLIYLRLDSNRFNGPVPPLNQSTLHTFNVSVNNLTGAVP

HMMPfam: PF00560
IPR001611
148-166 LRR_1
Leucine-rich repeat

RLRTLDFSFNNLTGPIPSG

superfamily: SSF56112
IPR011009
352-668 Kinase_like
Protein kinase-like domain

ATKSGSLVFCAGEAHVYTMDQLMTASAELLGRGTVGTTYKALLDSRLIVTVKRLDAIRLAGVGRDKFEHHMESVGALGHPNLVPLRAYFQAKEERLLIYDYLPNGSLSSLVHGTKSSRATPLHWTSCLKIAEDVAQGLSYIHQAWQLVHGNLKSSNVLLGQDFEACIADYCLVALATNPPLTSNDGQEDADAAAYKPPEARHKSLNYQSVKADVYSFGILLLELLTGKQPSKIPVLPLDEMIEWVRKVREEGEKKNGNWREDRDKFGMLTEVAVACSLASPEQRPTMWQVLKMLQEIKEAAVMEECELVMDSANSES

ProfileScan: PS50011
IPR000719
375-648 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

TASAELLGRGTVGTTYKALLDSRLIVTVKRLDAIRLAGVGRDKFEHHMESVGALGHPNLVPLRAYFQAKEERLLIYDYLPNGSLSSLVHGTKSSRATPLHWTSCLKIAEDVAQGLSYIHQAWQLVHGNLKSSNVLLGQDFEACIADYCLVALATNPPLTSNDGQEDADAAAYKPPEARHKSLNYQSVKADVYSFGILLLELLTGKQPSKIPVLPLDEMIEWVRKVREEGEKKNGNWREDRDKFGMLTEVAVACSLASPEQRPTMWQVLKMLQEI

HMMPfam: PF00069
IPR017442
379-643 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ELLGRGTVGTTYKALLDSRLIVTVKRLDAIRLAGVGRDKFEHHMESVGALGHPNLVPLRAYFQAKEERLLIYDYLPNGSLSSLVHGTKSSRATPLHWTSCLKIAEDVAQGLSYIHQAWQLVHGNLKSSNVLLGQDFEACIADYCLVALATNPPLTSNDGQEDADAAAYKPPEARHKSLNYQSVKADVYSFGILLLELLTGKQPSKIPVLPLDEMIEWVRKVREEGEKKNGNWREDRDKFGMLTEVAVACSLASPEQRPTMWQVLK

Gene3D: G3DSA:3.30.200.20
381-440 G3DSA:3.30.200.20

LGRGTVGTTYKALLDSRLIVTVKRLDAIRLAGVGRDKFEHHMESVGALGHPNLVPLRAYF

Gene3D: G3DSA:1.10.510.10
441-645 G3DSA:1.10.510.10

QAKEERLLIYDYLPNGSLSSLVHGTKSSRATPLHWTSCLKIAEDVAQGLSYIHQAWQLVHGNLKSSNVLLGQDFEACIADYCLVALATNPPLTSNDGQEDADAAAYKPPEARHKSLNYQSVKADVYSFGILLLELLTGKQPSKIPVLPLDEMIEWVRKVREEGEKKNGNWREDRDKFGMLTEVAVACSLASPEQRPTMWQVLKML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox