PRGDB00067000 (At.66942)

From PRG Wiki
Revision as of 20:59, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At.66942
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337319 (NM_105594)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPK1 (RECEPTOR-LIKE PROTEIN KINASE 1); kinase

DNA Sequence

AATGTCATTTTCTTTTTGAGTAAAGAAACTTTCTTCTTTTGCAACTTGAAAATTTTCGATTTCGAGAGCGAAGGAagagagagagagagggagagatcaaaaaaatttgtgaaaaaagagatttattttagggttttgttgattttctttgttcattttgccgtcgtctctttctctttcTCTTGTGAAGAAAAAGAAGAAAAATGAAACTTCTGGGTTTGGTCTTCTTGCTGTTTAATCTGTTTATGTTTTCGTTTTCTCGGAAACTTTTAACCGAGAGTGGTGGTGGTCTCCACGACGAAGCTGCTCTGTTGAAGTTGAAGAGTAGTTTCTTGGATCCAAATGGAGTTCTGTCTAGCTGGGTTTCCGACAGCTCATCAAACCATTGTTCTTGGTACGGTGTCTCTTGCAACTCTGATTCGAGAGTCGTTTCTTTAATTCTCAGAGGCTGTGATGAGCTTGAAGGTAGTGGTGTTCTTCATCTCCCAGATTTGTCTTCTTGTTCTTCAAGTAAAAGAAGACTTGGTGGTGTAATCTCTCCTGTTGTTGGAGATTTGTCTGAAATTAGGGTTTTATCTCTGTCTTTTAATGATCTTAGAGGTGAGATTCCAAAGGAGATTTGGGGGTTGGAGAAATTAGAGATTCTTGATCTTAAAGGTAACAACTTTATCGGTGGAATTAGGGTTGTTGATAATGTTGTTCTTAGGAAACTTATGAGTTTTGAGGATGAAGATGAAATTGGTCCAAGCTCAGCTGATGATGATTCTCCTGGTAAATCTGGATTGTATCCGATTGAGATAGCTTCTATTGTGTCAGCTTCAGTGATTGTCTTTGTGCTTCTTGTTCTTGTGATCTTGTTCATCTACACGAGGAAATGGAAACGAAACTCTCAGGTTCAGGTAGATGAGATCAAGGAGATTAAAGTGTTTGTTGACATTGGTATTCCTCTGACGTATGAGATCATTGTTAGAGCTACTGGTTACTTTAGTAACTCTAACTGTATCGGTCACGGCGGTTTCGGTTCGACTTATAAAGCAGAGGTGTCTCCAACGAATGTGTTTGCTGTTAAAAGACTCTCTGTTGGGAGGTTTCAAGGTGATCAACAGTTTCATGCTGAGATCTCTGCTCTTGAGATGGTTAGGCATCCGAATCTTGTTATGTTAATCGGTTACCATGCGAGCGAAACCGAGATGTTTCTTATTTACAACTACTTATCTGGAGGAAACCTTCAAGATTTCATTAAAGAGAGATCGAAAGCTGCTATTGAGTGGAAGGTACTTCACAAGATTGCTCTTGATGTAGCGCGTGCTCTCTCCTATCTTCACGAACAGTGTTCTCCTAAAGTCTTGCATAGAGATATCAAACCGAGTAACATACTCTTGGACAACAACTACAACGCTTATCTATCTGATTTCGGACTCTCGAAACTCTTGGGAACTTCGCAGTCTCATGTCACAACTGGTGTGGCTGGAACATTCGGATATGTAGCTCCAGAGTACGCAATGACATGCCGAGTCTCGGAGAAAGCAGATGTTTACAGCTATGGGATAGTCCTCTTGGAGCTGATATCGGACAAACGAGCTCTGGATCCTTCTTTCTCATCGCATGAGAACGGGTTCAACATTGTCTCGTGGGCTCATATGATGTTGAGTCAAGGCAAAGCGAAAGAAGTCTTCACCACAGGACTATGGGAGACTGGTCCTCCAGACGATTTGGTCGAGGTTCTGCATTTGGCACTCAAATGCACCGTCGATAGCCTCTCGATAAGGCCGACAATGAAACAAGCTGTAAGACTGCTGAAACGAATCCAGCCTTCTAGATTGTGATACAAAGCTAGAAGAAAGGTGTTTTTAGAGGATTTGTACAGCAGCAAACAAGTGCCTAGCCATTAGAATCTTTCTCAAGTCTGTTTTTTATATTTTCAGTGCTAGGGAGGTTTTTCATATGCATCATCAAAATGTTATTCTCAGTCTACTCTCTTGAAAACTGATATAAATGATGTTTCTTTCTCCTT


Protein sequences

Name Description Sequence
At.66942 translated coding region predicted by ESTScan from UniGene At.66942

MKLLGLVFLLFNLFMFSFSRKLLTESGGGLHDEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCNSDSRVVSLILRGCDELEGSGVLHLPDLSSCSSSKRRLGGVISPVVGDLSEIRVLSLSFNDLRGEIPKEIWGLEKLEILDLKGNNFIGGIRVVDNVVLRKLMSFEDEDEIGPSSADDDSPGKSGLYPIEIASIVSASVIVFVLLVLVILFIYTRKWKRNSQVQVDEIKEIKVFVDIGIPLTYEIIVRATGYFSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQPSRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-537 PTHR24420,FAMILY NOT NAMED

LVFLLFNLFMFSFSRKLLTESGGGLHDEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCNSDSRVVSLILRGCDELEGSGVLHLPDLSSCSSSKRRLGGVISPVVGDLSEIRVLSLSFNDLRGEIPKEIWGLEKLEILDLKGNNFIGGIRVVDNVVLRKLMSFEDEDEIGPSSADDDSPGKSGLYPIEIASIVSASVIVFVLLVLVILFIYTRKWKRNSQVQVDEIKEIKVFVDIGIPLTYEIIVRATGYFSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQP

HMMPanther: PTHR24420:SF820
6-537 PTHR24420:SF820

LVFLLFNLFMFSFSRKLLTESGGGLHDEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCNSDSRVVSLILRGCDELEGSGVLHLPDLSSCSSSKRRLGGVISPVVGDLSEIRVLSLSFNDLRGEIPKEIWGLEKLEILDLKGNNFIGGIRVVDNVVLRKLMSFEDEDEIGPSSADDDSPGKSGLYPIEIASIVSASVIVFVLLVLVILFIYTRKWKRNSQVQVDEIKEIKVFVDIGIPLTYEIIVRATGYFSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQP

superfamily: SSF52058
26-159 SSF52058,LRR

SGGGLHDEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCNSDSRVVSLILRGCDELEGSGVLHLPDLSSCSSSKRRLGGVISPVVGDLSEIRVLSLSFNDLRGEIPKEIWGLEKLEILDLKGNNFIGGI

HMMPfam: PF08263
IPR013210
31-70 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

HDEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCN

Gene3D: G3DSA:3.80.10.10
32-158 G3DSA:3.80.10.10

DEAALLKLKSSFLDPNGVLSSWVSDSSSNHCSWYGVSCNSDSRVVSLILRGCDELEGSGVLHLPDLSSCSSSKRRLGGVISPVVGDLSEIRVLSLSFNDLRGEIPKEIWGLEKLEILDLKGNNFIGG

superfamily: SSF56112
IPR011009
247-530 Kinase_like
Protein kinase-like domain

IPLTYEIIVRATGYFSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVR

Gene3D: G3DSA:3.30.200.20
250-328 G3DSA:3.30.200.20

TYEIIVRATGYFSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASET

ProfileScan: PS50011
IPR000719
261-535 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNSNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRI

HMMPfam: PF00069
IPR017442
264-528 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNCIGHGGFGSTYKAEVSPTNVFAVKRLSVGRFQGDQQFHAEISALEMVRHPNLVMLIGYHASETEMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQA

PatternScan: PS00107
IPR017441
267-289 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGGFGSTYKAEVSPTNVFAVK

Gene3D: G3DSA:1.10.510.10
329-530 G3DSA:1.10.510.10

EMFLIYNYLSGGNLQDFIKERSKAAIEWKVLHKIALDVARALSYLHEQCSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTGVAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVR

PatternScan: PS00108
IPR008271
381-393 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDIKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox