PRGDB00067369 (Bna.28020)

From PRG Wiki
Revision as of 20:52, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Bna.28020
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 65295500 (CN737681)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Brassica napus

Comment?

26RDBNT_UP_029_F04_23JAN2004_022 Brassica napus 26RDBNT Brassica napus cDNA 5', mRNA sequence

DNA Sequence

GAGCCGAAACTAGTGATGTTCAACAACAAGATCACTCTAGCGGAAACAATAGAAGCGACACGACAGTTCGATGAAGAGAACGTTCTCAGCAGAACCAAATACGGTTTGCTGTTCAAAGCTAATTACAACGATGGTATGGTTCTTTCGATACGCCGCTTACCTAATGGCTCTCTCTTGaacgagaacttgttcaagaaagaagctgaagttctcgggaaagtcaagcacaggaacattacggtccttagaggatactacGCTGGTCCAccggatttgaggttcttggtgtatgactacatgccgaatggaaacttgtctactctcctccaagaagcttctcaccaagatgGCCATGTCCTGAACTGGCCAATGCGTCACCTCATTGCTCTTGGGATCGCTCGTGGTCTCGGTTTCCTCCATCAATCCAACATGGTTCATGGTGATATAAAGCCACAGAATGTGCTCTTCGACGCTGACTTCGAAGCCCATTTATCCGACTTCGGGCTTGACCGTCTCACTGTTCGATCCCCGTCAAGAACAGCGGTCACATCAGCCACCATAGGGACGTTAGGCTACGTTTCTCCAGAAGCTACATTGTCAGGAGAGATCCACAAGAGAGTCCGACATCTA


Protein sequences

Name Description Sequence
Bna.28020 translated coding region predicted by ESTScan from UniGene Bna.28020

EPKLVMFNNKITLAETIEATRQFDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHKRVRHL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF687
1-205 SUBFAMILY NOT NAMED

EPKLVMFNNKITLAETIEATRQFDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHK

HMMPanther: PTHR24420
1-205 FAMILY NOT NAMED,FAMILY NOT NAMED

EPKLVMFNNKITLAETIEATRQFDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHK

Gene3D: G3DSA:3.30.200.20
10-84 no description

KITLAETIEATRQFDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRG

superfamily: SSF56112
IPR011009
12-207 Protein kinase-like (PK-like)
Protein kinase-like domain

TLAETIEATRQFDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHKRV

ProfileScan: PS50011
IPR000719
23-210 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHKRVRHL

HMMSmart: SM00219
IPR020635
23-210 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHKRVRHL

HMMSmart: SM00220
IPR002290
23-207 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEENVLSRTKYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEIHKRV

HMMPfam: PF00069
IPR017442
64-201 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FKKEAEVLGKVKHRNITVLRGYYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSG

Gene3D: G3DSA:1.10.510.10
85-203 no description

YYAGPPDLRFLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHGDIKPQNVLFDADFEAHLSDFGLDRLTVRSPSRTAVTSATIGTLGYVSPEATLSGEI

PatternScan: PS00108
IPR008271
144-156 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

MVHGDIKPQNVLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox