PRGDB00067779 (Can.12895)

From PRG Wiki
Revision as of 20:43, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Can.12895
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 282804858 (GO345910)
Gene Class Unknown
Domain Type
Gene Species Capsicum annuum

Comment?

CS01016A09 Hotpepper under oxidative stress Capsicum annuum cDNA 5', mRNA sequence

DNA Sequence

GCACGAGGAAAACTTGATTGTCATTTGCAACTCTAGCATTGTACTAGTGCTAGAAATTTGCAATTTCTTTGGCTAGAATAAAACAAAATAAGACAGAGATGGCTGGTATTTCTGGCCACTGGGCTTTTGCCTTTGGTCTCCTTGGTAACATTGTCTCGTTCATCGTGTTCCTTTCTCCAATTCCCACGTTCTATAAGATTTACAAGAAGAAATCAACAGAGGGTTATCAATCAATTCCATACGTGGTTGCTCTCTTTAGCTCCATGCTTTGGATATATTATGCATTATTGAAGACCAACGTTACCCTACTCATAACAATAAACTCCTTTGGTATGTTCATTGAGACTATCTACGTTGGTCTCTACCTTTTCTATGCACCAAAGAAAGCCAAAGTTCAAACTGCAAAAATGCTCATGTTATTTGTGGTGGCTGGCTTTGGTGCAATAGTCCTGGTTTCTCAGTTTCTATTGAAAGGTGCAGTTCGTGGACAAGTGGTTGGATGGATTTGCCTTATTTTCTCCTTGTGTGTGTTTGTAGCTCCCTTAGGCATTGTGAGACAAGTCATCAAAACAAAGAGTGTGGAATACATGCCACTTCTCCTATCAGTCTTCCTCACTTTAAGTGCTGTCATGTGGTTCTTCTATGGTCTTCTACTAAAAGACATTAACATTGCTGCTCCAAATGTATTGGGATTCATATTTGGTATACTCCAAATTGTGCTGTATGCAATATAC


Protein sequences

Name Description Sequence
Can.12895 translated coding region predicted by ESTScan from UniGene Can.12895

MAGISGHWAFAFGLLGNIVSFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNVTLLITINSFGMFIETIYVGLYLFYAPKKAKVQTAKMLMLFVVAGFGAIVLVSQFLLKGAVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNVLGFIFGILQIVLYAIY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
8-212 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

WAFAFGLLGNIVSFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNVTLLITINSFGMFIETIYVGLYLFYAPKKAKVQTAKMLMLFVVAGFGAIVLVSQFLLKGAVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNVLGFIFGILQIVLYAIY

HMMPfam: PF03083
IPR004316
11-97 MtN3_slv
RAG1-activating protein-1-related

AFGLLGNIVSFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNVTLLITINSFGMFIETIYVGLYLFYAPKKA

HMMPfam: PF03083
IPR004316
131-212 MtN3_slv
RAG1-activating protein-1-related

QVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKDINIAAPNVLGFIFGILQIVLYAIY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox