PRGDB00068331 (Ghi.1064)

From PRG Wiki
Revision as of 20:32, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ghi.1064
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164350949 (ES815762)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_282_67 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

GGCACGAGCTTTTGTATGCTAGAACAGGAAAGCGTACCAGTAAAGTGCAGAGTCCAACTACTGTACTCATACACCCTCATCATTCCGATGACCAGGATGGAGTTAAAATCACTGTCGCTGGATCAAGTGTCACTGGTGGAAGTGAAACTTTCAGCCACACGAGCAGTGGACCAAGTGATGTTCACTTGGTTGAGGCTGGCAACATGGTGATCTCGATTCAAGTTTTGAGGGATGTGACAAATAATTTCAGTGAGGAAAATGTGTTAGGAAGGGGTGGTTTTGGGACAGTTTACAAAGGGGAATTACATGATGGGACAAAGATTGCTGTGAAAAGGATGGAGTCCAGTGTTGTGAGCGAGAAGGGTTTGGCCGAGTTTAAGTCCGAGATTGCAGTTCTTACTAAGGTTCGTCACCGCCATTTAGTTGCACTTCTTGGATATTGCTTGGATGGAAATGAGAGGCTTCTTGTATATGAATATATGCCTCAAGGGACCCTTAGTCGGCATCTATTCAACTGGAAACATGAAGGTCTGAAACCACTTGAATGGACTAGACGACTTACAATTGCCCTAGATGTCGCTCGAGGTGTTGAGTATCTACATGGTCTGGCACAACAGAGTTTCATTCATCGAGATCTTAAGCCGTCAAATATTCTTCTCGGAGACGATATGCGTGCCAAGGTTGCAGATTTTGGCTTGGTCCGTCTAGCTCCTGTGGATGGCAAACAGTCTATTGAAACAAGACTAGCAGGAACCTTTGGGTATTTGGCACCGGAGTATGCAGTTACTGGACGAGTAACCACGAAGGTAGATGTGTTTAGCTTTGGTGTGATCCTCATGGAATTGATCTCAGGCCGAAGGGCACTTGATGAACTCAACCTGAAGAAAGCATGCACTTTGTGTCATGGTTTCCTCCGATGCCCATGAACAAGAAAACTTTCCGGAGGCCATTGATAAAACAATCCAGCTTGATAAGGAAAGCTAGCCAGTGGTAGCACAGTGACTGAACTTGCTGGCCCCGGTGTGCCAGGGACCCCAACAAAGGCCGAAATGAACCATGCGGTCATGGGCCTTTCATCCCATACAAAATTTCGGGAAACCACCAAAACCCGATTCCCAACAACTCTTATGGGTTTTAACCTTAAATTAATTTtaccccaaaccctttaaaaaaagggggaaccccttccggggggaaaaaccaaattggggaatgaacccccctctattttttttggggaaaaaaaaaaaaaaacaaacaccaaaaacaaaaacaaaaacaacttggcgggcccggcccccccgaggggttttttttgttttttttatttttt


Protein sequences

Name Description Sequence
Ghi.1064 translated coding region predicted by ESTScan from UniGene Ghi.1064

XHELLYARTGKRTSKVQSPTTVLIHPHHSDDQDGVKITVAGSSVTGGSETFSHTSSGPSDVHLVEAGNMVISIQVLRDVTNNFSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDELNLKKACTLCHGFLRCP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
51-291 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FSHTSSGPSDVHLVEAGNMVISIQVLRDVTNNFSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDE

HMMPanther: PTHR24420
51-291 FAMILY NOT NAMED,FAMILY NOT NAMED

FSHTSSGPSDVHLVEAGNMVISIQVLRDVTNNFSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDE

superfamily: SSF56112
IPR011009
55-308 Protein kinase-like (PK-like)
Protein kinase-like domain

SSGPSDVHLVEAGNMVISIQVLRDVTNNFSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDELNLKKACTLCHGFLRCP

Gene3D: G3DSA:3.30.200.20
66-146 no description

AGNMVISIQVLRDVTNNFSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLG

ProfileScan: PS50011
IPR000719
83-308 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDELNLKKACTLCHGFLRCP

HMMSmart: SM00219
IPR020635
83-305 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDELNLKKACTLCHGFL

HMMSmart: SM00220
IPR002290
83-305 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDELNLKKACTLCHGFL

HMMPfam: PF00069
IPR017442
85-291 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EENVLGRGGFGTVYKGELHDGTKIAVKRMESSVVSEKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDE

PatternScan: PS00107
IPR017441
89-111 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGTVYKGELHDGTKIAVK

Gene3D: G3DSA:1.10.510.10
147-292 no description

YCLDGNERLLVYEYMPQGTLSRHLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELISGRRALDEL

PatternScan: PS00108
IPR008271
208-220 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox