PRGDB00068441 (Ghi.8729)

From PRG Wiki
Revision as of 20:30, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ghi.8729
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84164748 (DR453396)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

CM012G05 Cotton Lambda Zap Express Library Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

CGAGGCTTACAAGTCGGTCTCTGCATGATCATTCTCCTCGAGGTCAACAATCAAGGAAATAGAGCTGAATCAACTTGGAGATGACAATGATGGGAATGAGACCAATTCATCAATGCAATATGAGTTGCAAAAATGCTTGGAGGTGCTCCTGAATACAAATTCATCGGATTGCAGATGGTTTTGTTATGGAATTCTAAAAGCTGCAACTGATCAATTCTCCACAGAGAACTTGATTGGGAAAGGAGGGAGCAACCGTGTCTATAAAGGGATCCTTCCGGATAACAAAGCAGTGGCTGTGAAGATTCTGGAGTCATCAAAAGAGGCATGCAAGGATTTCGCAAATGAAATCGAAATAATCTCCTCACTGAAGCATAAACACATCATGCCTCTAATAGGTATCTGCATTAAAGATCATGATCTTATATCCGTCTATGATTTCTCATCCAAGGGAAGCTTAGAAGAAATTCTGCATGGGAAGAACAAAGGAAAACATGCCTTGCCATGGGAGCTCAGATATAACGTTGCTGTCGGGATTGCTGAAGGCCTAGATTACCTACATAATGAGCTTTCTCGACCTGTTATTCATAGGGATATCAAGTCTTCAAATATTCTTCTTTCAGATGGGTTCGAACCAAAGTTATCTGACTTTGGGTAGCCATATGGGGACAACTGATCGTCATTCTGATTCCACTGATGTTGTGGCACCTCGGGTATTAACTCCTGATATTATGTATGGTACTTACGACAGATGAGTTACCTTCGGGTGTCAACCAG


Protein sequences

Name Description Sequence
Ghi.8729 translated coding region predicted by ESTScan from UniGene Ghi.8729

XEAYKSVSAXSFSSRSTIKEIELNQLGDDNDGNETNSSMQYELQKCLEVLLNTNSSDCRWFCYGILKAATDQFSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDIMYGTYDRXVTFGCQPX

Domains

Domain Start-End Description Sequence

Seg: seg
6-16 seg

SVSAXSFSSRS

HMMPanther: PTHR24420:SF425
13-218 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SSRSTIKEIELNQLGDDNDGNETNSSMQYELQKCLEVLLNTNSSDCRWFCYGILKAATDQFSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALG

HMMPanther: PTHR24420
13-218 FAMILY NOT NAMED,FAMILY NOT NAMED

SSRSTIKEIELNQLGDDNDGNETNSSMQYELQKCLEVLLNTNSSDCRWFCYGILKAATDQFSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALG

superfamily: SSF56112
IPR011009
43-241 Protein kinase-like (PK-like)
Protein kinase-like domain

LQKCLEVLLNTNSSDCRWFCYGILKAATDQFSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTP

Gene3D: G3DSA:3.30.200.20
54-133 no description

NSSDCRWFCYGILKAATDQFSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIG

ProfileScan: PS50011
IPR000719
73-259 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDIMYGTYDRXVTFGCQPX

HMMSmart: SM00219
IPR020635
73-254 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDIMYGTYDRXVTF

HMMSmart: SM00220
IPR002290
73-254 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSTENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDIMYGTYDRXVTF

HMMPfam: PF00069
IPR017442
75-243 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TENLIGKGGSNRVYKGILPDNKAVAVKILESSKEACKDFANEIEIISSLKHKHIMPLIGICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDI

Gene3D: G3DSA:1.10.510.10
134-244 no description

ICIKDHDLISVYDFSSKGSLEEILHGKNKGKHALPWELRYNVAVGIAEGLDYLHNELSRPVIHRDIKSSNILLSDGFEPKLSALGSHMGTTDRHSDSTDVVAPRVLTPDIM

PatternScan: PS00108
IPR008271
194-206 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox