PRGDB00068444 (Ghi.8818)

From PRG Wiki
Revision as of 20:29, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ghi.8818
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164353189 (ES839144)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Gossypium hirsutum

Comment?

UFL_051_03 Cotton fiber 0-10 day post anthesis Gossypium hirsutum cDNA, mRNA sequence

DNA Sequence

CTCGCTCAAAGCAAAGAAAGGCGAAAAGAAGCAACttttttttttGGGAGTTAGGTTGAAAATTTGAAGTTTAAGCCAATGGGAGCTCGTTGCTCCAAACTTTCACTTTGCTGGTGGCCGTCAAATCTCAAGTCAAACCTCAACGACTCCTCCGATCTCGAGAATGGGGAGGAAGCGTTACCTGGATTCAGCGAGTACAGCTTGGACCAATTAAGAGCTGCCACAGCAGGTTTCTCAACGGACAACATTGTATCGGAGCATGGAGAAAAAGCTCCCAATGTAGTTTACCGAGGGACCCTCGACGAGGATCGTTTGATTGCTGTTAAACGCTTCAACAGATCGGCTTGGCCTGATCCTCGACAGTTCCTCGAAGAAGCGAGAGCAGTTGGGCACTTAAGAAGCGATCGGTTGGCCAATTTGATTGGTTGTTGCTGTGAAGGAGATGAGAGATTGTTAGTAGCTGAGTTTATGCCTAATGAGACTCTCTCTAAGCATCTTTTCCACTGGGAAAATCAGCATATGAAATGGCCGATGAGGCTGAGAGTCGCATTATATCTAGCACAGGCACTTGAATATTGCAGTAGTAGACGGAGAGCGTTATACCATGACCTTAATGCTTATAGAATCTTGTTTGATCAGGATGGTAATCCCAGACTCTCTAGCTTTGGCCTTATGAAGAACAGCAGAGACGGAAAAAGTTATAGTACAAACTTGGCTTTCACCCCTCCAGAATACCTAAGGACAGGAAGGGTTATCCCGGAGAGTGTGGTTTACAGTTTTGGCACCCTTTTGCTTGATCTTCTCAGTGGCAAGCATATACCACCAAGCCATGCACTGGACCTAATACGGGGAAAAAACTTTTTGATTCTGCTGGACTCATGCCTGGGAGGGTCAATTTTCAAATAATGATGG


Protein sequences

Name Description Sequence
Ghi.8818 translated coding region predicted by ESTScan from UniGene Ghi.8818

MGARCSKLSLCWWPSNLKSNLNDSSDLENGEEALPGFSEYSLDQLRAATAGFSTDNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHXTGPNTGKKLFDSAGLMPGRVNFQIMMX

Domains

Domain Start-End Description Sequence

Seg: seg
15-29 seg

SNLKSNLNDSSDLEN

HMMPanther: PTHR24420:SF457
19-251 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SNLNDSSDLENGEEALPGFSEYSLDQLRAATAGFSTDNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSH

HMMPanther: PTHR24420
19-251 FAMILY NOT NAMED,FAMILY NOT NAMED

SNLNDSSDLENGEEALPGFSEYSLDQLRAATAGFSTDNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSH

superfamily: SSF56112
IPR011009
24-246 Protein kinase-like (PK-like)
Protein kinase-like domain

SSDLENGEEALPGFSEYSLDQLRAATAGFSTDNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKH

Gene3D: G3DSA:3.30.200.20
37-123 no description

FSEYSLDQLRAATAGFSTDNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDE

ProfileScan: PS50011
IPR000719
55-279 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHXTGPNTGKKLFDSAGLMPGRVNFQIMMX

HMMSmart: SM00220
IPR002290
55-277 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHXTGPNTGKKLFDSAGLMPGRVNFQIM

HMMSmart: SM00219
IPR020635
55-278 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

DNIVSEHGEKAPNVVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHXTGPNTGKKLFDSAGLMPGRVNFQIMM

HMMPfam: PF07714
IPR001245
68-252 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VVYRGTLDEDRLIAVKRFNRSAWPDPRQFLEEARAVGHLRSDRLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHX

Gene3D: G3DSA:1.10.510.10
124-248 no description

RLLVAEFMPNETLSKHLFHWENQHMKWPMRLRVALYLAQALEYCSSRRRALYHDLNAYRILFDQDGNPRLSSFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox