PRGDB00069484 (Gra.1199)

From PRG Wiki
Revision as of 20:02, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gra.1199
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48799835 (CO101149)
Gene Class Unknown
Domain Type
Gene Species Gossypium raimondii

Comment?

GR__Eb0027E08.r GR__Eb Gossypium raimondii cDNA clone GR__Eb0027E08 3', mRNA sequence

DNA Sequence

CTCCCAACTCCATTCAttctctctctcttctctTTTGCTTAATACAAATGGCCTTAATGGCAGATGCAGATCACCATTCCTTGGCAGTTGCATTTGGTGTCTTAGGTAACATCATCTCAGTCCTTGTATATCTGGCTCCACTACCAACATTCTACAGAATATACAAAAAGAAATCAACGGAAAGTTTCCAATCACTGCCTTACCAGGTGGCATTGTTCAGCTCAATGCTATGGCTTTATTACGCGTTAATGAAAAAGGGTGCCTTCCTTCTCATCACCATCAACTCCTTTGGGTGTGTTGTAGAGACTATATACATAGCTATGTACATAGCTTATGCAACCAAGAACAGCAGGGTGTCTGCTATAAAACTTTTTGTAGCTATGAACGTTGCGCTCTTCTCATTCATCATTATTCTCACACACTTCCTGGTGAAAGGTTCAATTCGTGTCCAGGTTCTGGGTTGGATTTGCGTTGCTATCTCTGTATCTGTGTTTGCAGCCCCCTTAAACATTGTGGCACGAGTAATTCGAACAAAGAGCGTTGAGTtcatgcctttcaacttatcatttttcctaacattgagtgcagtaatgtggtttgcctatggactatttatgaaggacctctgtgtagctcttccgaatgtgataggcttcgtcctggggatgctccagatgctgctttacgcaatttacagaaacagcgaaaaggttatagaggagaagaagataccagaacaaatgaaaggtgttgtagtgcttagcacattaggcccctcagaagtgtatcctgtangtgtagatattgaaccagatgttaagccaaagaagatacgacagagaatgaacagacaggggagcctgacaaaaatgatgtcaaat


Protein sequences

Name Description Sequence
Gra.1199 translated coding region predicted by ESTScan from UniGene Gra.1199

MALMADADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLWLYYALMKKGAFLLITINSFGCVVETIYIAMYIAYATKNSRVSAIKLFVAMNVALFSFIIILTHFLVKGSIRVQVLGWICVAISVSVFAAPLNIVARVIRTKSVEFMPFNLSFFLTLSAVMWFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSEKVIEEKKIPEQMKGVVVLSTLGPSEVYPVXVDIEPDVKPKKIRQRMNRQGSLTKMMSN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
3-257 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

LMADADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLWLYYALMKKGAFLLITINSFGCVVETIYIAMYIAYATKNSRVSAIKLFVAMNVALFSFIIILTHFLVKGSIRVQVLGWICVAISVSVFAAPLNIVARVIRTKSVEFMPFNLSFFLTLSAVMWFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSEKVIEEKKIPEQMKGVVVLSTLGPSEVYPVXVDIEPDV

HMMPfam: PF03083
IPR004316
15-100 MtN3_slv
RAG1-activating protein-1-related

AFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLWLYYALMKKGAFLLITINSFGCVVETIYIAMYIAYATKN

HMMPfam: PF03083
IPR004316
135-220 MtN3_slv
RAG1-activating protein-1-related

QVLGWICVAISVSVFAAPLNIVARVIRTKSVEFMPFNLSFFLTLSAVMWFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox