PRGDB00069508 (Gra.3013)

From PRG Wiki
Revision as of 20:01, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gra.3013
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48785197 (CO090179)
Gene Class Unknown
Domain Type
Gene Species Gossypium raimondii

Comment?

GR__Ea10A08.f GR__Ea Gossypium raimondii cDNA clone GR__Ea10A08 5', mRNA sequence

DNA Sequence

CTCTTCCAAGAGTGATCAGTGATATTCGTTGGAGGGAGAAAAGATGGACTATGTGTACGGACCAGGAAAGAACCATCTCTTTGTTCCAGGGCCGGTTAACATCCCGGAACCAGTTCTTCGAGCCATGAACAGGAACAATGAGGATTACCGTTCCCCTGCCATTCCTGCCATGACAAAAAATCTTCTTGAAGATGTCAAGAAAATTTTCAAGACTAGTACTGGAACTCCCTTTTTGATTCCAACTACAGGAACTGGTGCatgggagagtgcactcactaataccctgtcccctggagatcgaactgtatcttttctaattggacaattcagtctgctgtggattgatcaacaacaacgcctcaacttcaacgtcgacgttgttgaaagtgagtggggtcaaggtgctaaccttgacattctgGCAGAAAAACTTGCAGCTGATCACTCCCACACAATCAAGGCCATTTGCATTGTTCACAATGAGACTGCAACCGGAGTCACCAACAACCTGGCTACTGTGAGAAAATTACTTGATCATTATAGGCacccagcattacttcttgttgatggagtttcctctattTGTGCCCTTGATTTTCGTATGGATGAGTGGGGAGTAGACGTCGCACTAACCGGTTCTCAGAAGGCACTTTCTCTTCCCACAGGACTGGGTATTGTTTGTGCAAGCCCCAAAGCTTTGGAGGCATCCAAAAGTGCAAAATCAGTTAGAGTTTTCTTCGACTGGAATGACTACCTCAAGTTCTACAAACTGGGAACATTTTGGCCATACACCCCTTCAATCCAGCTATTGTATGGGCTAAGAGCCGCTCTTGATCTTATATTCGAGGAAGGACTCGACAATGTGATTGCAAG


Protein sequences

Name Description Sequence
Gra.3013 translated coding region predicted by ESTScan from UniGene Gra.3013

MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIAX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-276 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIA

HMMPanther: PTHR21152
1-276 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIA

superfamily: SSF53383
IPR015424
7-276 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIA

HMMPfam: PF00266
IPR000192
12-274 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNV

Gene3D: G3DSA:3.40.640.10
IPR015421
21-269 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEE

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox