PRGDB00069509 (Gra.3031)

From PRG Wiki
Revision as of 20:01, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gra.3031
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48789299 (CO090613)
Gene Class Unknown
Domain Type
Gene Species Gossypium raimondii

Comment?

GR__Ea10K24.f GR__Ea Gossypium raimondii cDNA clone GR__Ea10K24 5', mRNA sequence

DNA Sequence

TTCAGTCTTCTTTGGATCGATCAACCCATCGTCTCAAGTTCAACGTCGACGTTGTCGAAAGTGAGTGGGGACAAGGTGCTAACCTCGACGTTTTGGCCGAAAAACTCGCGGCCGATCGTACGCACACCATTAAGGCTATTTGTATTGTTCACAACGAAACCGCGACTGGAGTTACAAACAACTTGGCCACAGTGAGAAAACTACTAGATCATTACGGGCACCCAGCACTGCTTCTCGTCGATGGAGTTTCCTCGATTTGTGCTCTCGATTTCCGTATGGATGAATGGGGAGTTGACGTAGCCTTAACCGGCTCGCAAAAGGCGCTTTCTCTTCCAACCGGGATCGGTATTGTTTGCGCTAGCCCGAAAGCtctcgaggcgaccaaaacagcgaaatcggttcgggttttcttcgattggaacgactaccttaagttttacaaattaggaacattttggccatacactccttcaattcaactcttgtatggactaagagcagctttggaccttatttttgaggaaggacttgataatatcaTTGAAAGGCATAGTCGTTTGGGCAAAGCAACAAGGCTTGCGGTGGAAGCATGGGGCTTGAAGAATTGCACACAAAAGGAGGAATGGTTCAGTGACACGGTGACGGCGGTGCTTGTTCCACCATATATTGATAGTTCGGAAATCGTTAAACGGGGATGGAAGAGATACAATTTGAGCTTAGGTCTTGGCCTTAACAAAGTGGCAGGAAAAGTTTTCAGAATAGGACATCTTGGAAACCTAAACGAGTTGCAACTGCTGGGTTGTTTAGCTGGTGTGGAGATGATACTGAAAGATGTTGGATACCCAGTTAAGCTTGGAAGTGGAGTTGCTGCTGCATCT


Protein sequences

Name Description Sequence
Gra.3031 translated coding region predicted by ESTScan from UniGene Gra.3031

XQSSLDRSTHRLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAAS

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
11-283 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

RLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

HMMPfam: PF00266
IPR000192
11-229 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

RLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIV

HMMPanther: PTHR21152:SF7
11-293 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAAS

HMMPanther: PTHR21152
11-293 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

RLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAAS

Gene3D: G3DSA:3.40.640.10
IPR015421
11-164 no description
Pyridoxal phosphate-dependent transferase, major r

RLKFNVDVVESEWGQGANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYG

PatternScan: PS00595
IPR020578
98-118 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
165-289 no description
Pyridoxal phosphate-dependent transferase, major r

LRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox