PRGDB00070774 (Mdo.4934)

From PRG Wiki
Revision as of 14:46, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Mdo.4934
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 55858600 (CV883392)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

Mdlv3_4035j04.y1 Mdlv3 Malus x domestica cDNA clone Mdlv3_4035j04 5' similar to TR:O81248 O81248 ALANINE:GLYOXYLATE AMINOTRANSFERASE ;, mRNA sequence

DNA Sequence

TTCCACTCGTTGCCTTTGGCTTAGGTTCGGCTCAATTTGTGAGCCTGCAGGGAGGTGAAAATGGACTACGTTTATGGACCAGGAAGGAACCACCTCTTTGTTCCAGGCCCGGTCAATATTCCGGAGCCAGTCCTTCGGGCCATGAACAGGAACAATGAGGATTACCGTTCTCCCGCTGTCCCAGCAATGACCAAAACTCTGCTCGAGGATGTGAAGAAGATTTTCAAGACTACATCTGGAACTCCATTTATGATCCCTACCACAGGCACTGGTGCATGGGAGAGTGCACTTACAAACACATTATCTCCTGGAGACCGGATTGTATCTTTCCTGATTGGCCAATTCAGTTTACTGTGGATCGATCAGCAGCAGCGCCTTAAGTTCAATGTGGATGTTGTAAAAAGTGATTGGGGCCAAAGTGCCACCCTTGCCGTTCCGGAATCCAAAATTGCACACGATACACCGCACACTATAAAGGCAATATGACTTTGTTCACTAATGAAAAAGCCCACGGAAGTCTAAGACATTTAGGCTAATCTCCATAAAAATACACGGTAACTCACTAGCATCCGGCAATCCACCCCATGCTGATGGAGCTGCATATTTCCCCGCCCCTGAAACTACAAGCTCCCAAACACGCGTCAGATTTACACCTCATCCCACAAGACACCTATCCACTCTGCCACGACGCACCCTATTCCCAAACACAACTCTAAAACTGCCATCACACACATCTCACTTCCAAATATCATTGATCCTGGATCCCATCGACCATCCCATAACACGCATAACTAACTAAAT


Protein sequences

Name Description Sequence
Mdo.4934 translated coding region predicted by ESTScan from UniGene Mdo.4934

MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDTPHTIKAIXLCSLMKKPTEV

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
1-134 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDT

HMMPanther: PTHR21152:SF7
1-143 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDTPHTIKAIXL

HMMPanther: PTHR21152
1-143 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDTPHTIKAIXL

HMMPfam: PF00266
IPR000192
12-134 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDT

Gene3D: G3DSA:3.40.640.10
IPR015421
21-142 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVKSDWGQSATLAVPESKIAHDTPHTIKAIX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox