PRGDB00071016 (Mdo.24146)

From PRG Wiki
Revision as of 14:53, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Mdo.24146
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 46614753 (CN493894)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

Mdfw2007p06.y1 Mdfw Malus x domestica cDNA clone Mdfw2007p06 5' similar to TR:O24436 O24436 RECEPTOR KINASE-LIKE PROTEIN. ;, mRNA sequence

DNA Sequence

AGCCTGTAGTGCACTGTGATTTGAAGCCTAGCAACATCCTTCTTGACGAAGACATGGTTGCACATGTGGGGGACTTTGGTCTTGCTAAAATTTTGGCAGGAAACAAGGATGCAACACAAACCAGAACTCTTGGTACACTTGGTTATGTTGTACCAGAGTATGGTTCAGCAGGAAAAGTGTCAACAAGAGGTGATGTGTATAGCTATGGAATCATGTTGTTTGAAATAATTGCAAGAAAGAGGCCAACAGATGGAATGTTTACGGAAGAACTGACCCTGAGGAAATGGATAAATGCGTCGCTCCCTGACGGTATTCTAGGAGTAGTGGATATTGGTTTATTGAGCACAGAAGAGGGAAGAGAGATGAATGCCGCNAAACGTATCATTTTATCAATCATGGACATCGGCTTGAGATGTTCCCAAGAAGTGCCAGAAGAAAAAATGGATATCAAAGAAGTGTTGCGGAAACCCCATAAAATAAAATCGGCACTTGGA


Protein sequences

Name Description Sequence
Mdo.24146 translated coding region predicted by ESTScan from UniGene Mdo.24146

XPVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKPHKIKSALG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-161 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKPHKIK

HMMPanther: PTHR24420:SF474
2-161 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKPHKIK

HMMPanther: PTHR24420
2-161 FAMILY NOT NAMED,FAMILY NOT NAMED

PVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKPHKIK

superfamily: SSF56112
IPR011009
2-157 Protein kinase-like (PK-like)
Protein kinase-like domain

PVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKP

Gene3D: G3DSA:1.10.510.10
2-159 no description

PVVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGMFTEELTLRKWINASLPDGILGVVDIGLLSTEEGREMNAAKRIILSIMDIGLRCSQEVPEEKMDIKEVLRKPHK

PatternScan: PS00108
IPR008271
3-15 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHCDLKPSNILL

HMMPfam: PF00069
IPR017442
3-86 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VVHCDLKPSNILLDEDMVAHVGDFGLAKILAGNKDATQTRTLGTLGYVVPEYGSAGKVSTRGDVYSYGIMLFEIIARKRPTDGM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox