PRGDB00071144 (Mtr.745)

From PRG Wiki
Revision as of 14:56, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Mtr.745
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 161105686 (EY474269)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

META360TF JCVI-MT3 Medicago truncatula cDNA 5', mRNA sequence

DNA Sequence

GTagtggttggtgttgttgttttgcttttggtgggtgttgctctgtttttcctctgtttCCGGCGACGGCGACAACAGAAGCTACAACCACCGGCGGTGGGTAAAGCTTTCTCAGATTCTAACACAAAGAAAGTTTCAGAGGTTACTTCAACATCTCAATCTTGGTCTCTTTCTTCTGAGGGAATTCGTTATGCGGTTGATTCATTGACTGTGTACAAATATGAGGATTTGCAAAATGCAACAAATTTTTTCAGTGAAGAGAATAAGATTAAAGGTTCTGTTTATAGAGCTTCTTTTAAAGGTGATGATGCTGCTGTTAAGATTCTTAAAGGTGATGTTTCTTCTGAGATTAACATTTTGAAGAGGATTAATCATGCTAATATTATAAGGTTGTCTGGTTTTTGTGTCTACAAAGGTAACACTTATCTTGTTTATGAGTTTGCTGAAAATAATTCTCTTGATGATTGGCTTCACTCTGAGAAGAACAAGGATAAGAATTATTCGAATTCCATGTGTTTGAGTAGGTTTCAGAGAGTTCAGATTGCTCATGATGTAGCTGATGCACTTAATTACCTTCATAATTATGCTAATCCCCCTCATGTTCATAAGAATTTGAAAAGTGGTAATATTCTTTTAGATGGAAAATTTAGAGGTAAAGTTTCAAATTTTGGGTTGGCAAGAGTTATGGAGAATGAAAGAGGGGATGAAAGGGTTTCAATTAACAAGACATGTAATAGGGACA


Protein sequences

Name Description Sequence
Mtr.745 translated coding region predicted by ESTScan from UniGene Mtr.745

VVVGVVVLLLVGVALFFLCFRRRRQQKLQPPAVGKAFSDSNTKKVSEVTSTSQSWSLSSEGIRYAVDSLTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERGDERVSINKTCNRDX

Domains

Domain Start-End Description Sequence

Seg: seg
1-13 seg

VVVGVVVLLLVGV

HMMPanther: PTHR24420:SF481
1-234 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VVVGVVVLLLVGVALFFLCFRRRRQQKLQPPAVGKAFSDSNTKKVSEVTSTSQSWSLSSEGIRYAVDSLTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERG

HMMPanther: PTHR24420
1-234 FAMILY NOT NAMED,FAMILY NOT NAMED

VVVGVVVLLLVGVALFFLCFRRRRQQKLQPPAVGKAFSDSNTKKVSEVTSTSQSWSLSSEGIRYAVDSLTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERG

Gene3D: G3DSA:3.30.200.20
11-133 no description

VGVALFFLCFRRRRQQKLQPPAVGKAFSDSNTKKVSEVTSTSQSWSLSSEGIRYAVDSLTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSG

Seg: seg
15-29 seg

LFFLCFRRRRQQKLQ

ProfileScan: PS50011
IPR000719
22-248 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RRRQQKLQPPAVGKAFSDSNTKKVSEVTSTSQSWSLSSEGIRYAVDSLTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERGDERVSINKTCNRDX

Seg: seg
45-60 seg

VSEVTSTSQSWSLSSE

superfamily: SSF56112
IPR011009
69-231 Protein kinase-like (PK-like)
Protein kinase-like domain

LTVYKYEDLQNATNFFSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMEN

HMMSmart: SM00219
IPR020635
84-248 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERGDERVSINKTCNRDX

HMMSmart: SM00220
IPR002290
84-245 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEENKIKGSVYRASFKGDDAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENERGDERVSINKTCN

HMMPfam: PF07714
IPR001245
103-232 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DAAVKILKGDVSSEINILKRINHANIIRLSGFCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENE

Gene3D: G3DSA:1.10.510.10
134-232 no description

FCVYKGNTYLVYEFAENNSLDDWLHSEKNKDKNYSNSMCLSRFQRVQIAHDVADALNYLHNYANPPHVHKNLKSGNILLDGKFRGKVSNFGLARVMENE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox