PRGDB00071581 (Nta.6136)

From PRG Wiki
Revision as of 15:09, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Nta.6136
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76868860 (DV159853)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

KP1B.101J04F.050722T7 KP1B Nicotiana tabacum cDNA clone KP1B.101J04, mRNA sequence

DNA Sequence

GGAACTGGTGCATGGGAAAGTGCACTCACAAACACGTTGTCTCCTGGTGATCGCATTGTATCTTTCCTCATCGGTCAGTTCAGTCTGCTTTGGATTGATCAACAGAAACGTCTCAACTTTGATGTTGATGTTGTTGAGAGTGACTGGGGCCAAGGTGCAGACCTTGAAGCTTTAGCCTCCAAAATCGCAGCTGATAAGTCGCATACTATTAAGGCGATTTGCATTGTGCATAATGAGACAGCCACTGGAGTTACCAACAACTTGGCTACTGTAAGGAAAATACTCGATCACTACCAGCATCCTGCTCTCTTACTTGTTGATGGAGTGTCCTCAATTTGTGCACTTGATTTTCGCATGGATGAATGGGGCGTTGATGTGGCGCTTACTGGTTCGCAGAAAGCACTTTCCCTTCCCACCGGACTCGGGATAGTCTGTGCTAGTCCCAAGGCTCTTGAGGCCGCCAAAACTGCAAAATCAGTGAGAGTTTTCTTTGACTGGAGTGATTACCTTAAGTTCTACAAGATGGGAACTTATTGGCCATATACTCCTTCAATCCAACTTTTGTATGGACTCCGAGCTGCTCTCGACCTTCTTTTTGAGGAAGGTCTCGAAAATGTTATTGCAAGACACGCTCGCTTGGGCAAAGCAACAAGACTTGCCGTGGAGGCATGGGGATTGAAGAACTGTACTCAGAAGGAGGAATGGTTCAGTGACACCGTCACAGCTGTGGTTGTTCCTCCATATATCGATAGTGTTGAAATCGTGAAAAGGGCATGGAAGCGATACAACTTAAGCTTAGGTCTTGGCCTAAACAAAGTGGCAGGAAAGGTTTTCAGAATAGGACATCTTGGCAACTTGAATGAGTTGCAACTACTGGGATGTCTTGCTGGAGTGGAAATGGTACTTAAGGATGTTGGTTATCCAGTGAAG


Protein sequences

Name Description Sequence
Nta.6136 translated coding region predicted by ESTScan from UniGene Nta.6136

GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVK

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
1-309 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPV

HMMPanther: PTHR21152:SF7
1-310 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVK

HMMPanther: PTHR21152
1-310 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVK

Gene3D: G3DSA:3.40.640.10
IPR015421
1-189 no description
Pyridoxal phosphate-dependent transferase, major r

GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLY

HMMPfam: PF00266
IPR000192
8-256 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

ALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQGADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVK

PatternScan: PS00595
IPR020578
124-144 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Seg: seg
187-198 seg

LLYGLRAALDLL

Gene3D: G3DSA:3.90.1150.10
IPR015422
190-310 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox