PRGDB00071586 (Nta.6533)

From PRG Wiki
Revision as of 15:09, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Nta.6533
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 94323760 (EB677362)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KG9B.101I24F.060120T7 KG9B Nicotiana tabacum cDNA clone KG9B.101I24, mRNA sequence

DNA Sequence

GGAGATTATTAGGTCAAGGCAACTTTGCTAAGGTTTATTATGGAAGGAATCTGAAAACGGGACAGGGTGTAGCTATTAAGGTAATTGATAAAGAGAAGGTTCTAAAGGCTGGATTGATAGAACAGACCAAACGAGAGATATCTGTTATGGCACTGGTCAAACACCCACATGTTTTGCAGCTATACGAGGTCATGGCAACTAAGTCTAAGATCTACTTTGCGATCGAACATGCCAAAGGCGGGGAGCTTTTTAACAAGCTGGCAAAGGGGAGGCTCAAGGAAGATGTTGCTAGAAAGTTCTTTCAGCAACTGATCGCTGCTGTTGAATTTTGCCACAGCCGAGATGTTTATCACCGTGATCTCAAACCGGAAAATCTCCTGCTGGATGAGAACGGAAACCTAAAGGTCTCAGACTTTGGATTGAGTGCATTGGCTGAGTCTAAGCGGCAAGATGGCTTACTCCACACAACGTGCGGTACGCCAGCATATGTTGCGCCCGAGGTGATTGGTAGAAAAGGATATGATGGTGCCAAAGCTGACATCTGGTCTTGTGGGGTGATCTTATTTGTCTTGTTGGCTGGTTATCTTCCGTTCCATGACTCAAATCTTATGAATATGTATAGGAAGATAAGCAGGGCAGAATACAAATGCCCTAATTGGTTCCCTCTAGAAGTGCGTAAACTTCTCTCTAGAATCCTCGACCCAAACCCTCATACAAGGATTTCGATAGCCAAAATTAAGGAAAGCTCCTGGTTTAAGAAAGGGTTGGAATCCAGACACGTGAGAACCAAACTAGTACAGAACCAAAATGTTATAGCAGATGGAGATGATGTTTCGAGTTTGAATTTGGAGAACAGTACCTCTTCCTCTGACACAAAGCTAGAATTGGCAAAACCTACAAATCTTAATGCATTTGATATCATCTCTCTTTCAAGTGGGTTTGACTTGTCTGGTTTATTCAT


Protein sequences

Name Description Sequence
Nta.6533 translated coding region predicted by ESTScan from UniGene Nta.6533

XRLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIADGDDVSSLNLENSTSSSDTKLELAKPTNLNAFDIISLSSGFDLSGLFX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-252 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWF

HMMSmart: SM00220
IPR002290
1-252 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XRLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWF

HMMSmart: SM00219
IPR020635
1-252 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XRLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWF

HMMPanther: PTHR24343:SF45
2-274 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

RLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIAD

HMMPanther: PTHR24343
2-274 FAMILY NOT NAMED,SERINE/THREONINE KINASE

RLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIAD

HMMPfam: PF00069
IPR017442
2-252 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWF

superfamily: SSF56112
IPR011009
2-280 Protein kinase-like (PK-like)
Protein kinase-like domain

RLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKEDVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIADGDDVSS

Gene3D: G3DSA:3.30.200.20
2-94 no description

RLLGQGNFAKVYYGRNLKTGQGVAIKVIDKEKVLKAGLIEQTKREISVMALVKHPHVLQLYEVMATKSKIYFAIEHAKGGELFNKLAKGRLKE

PatternScan: PS00107
IPR017441
4-27 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGNFAKVYYGRNLKTGQGVAIK

Gene3D: G3DSA:1.10.510.10
95-288 no description

DVARKFFQQLIAAVEFCHSRDVYHRDLKPENLLLDENGNLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWFPLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIADGDDVSSLNLENSTS

PatternScan: PS00108
IPR008271
116-128 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

Seg: seg
279-290 seg

SSLNLENSTSSS

ProfileScan: PS50816
IPR018451
297-321 NAF
NAF/FISL domain

AKPTNLNAFDIISLSSGFDLSGLFX

HMMPfam: PF03822
IPR004041
298-320 NAF
NAF domain

KPTNLNAFDIISLSSGFDLSGLF

Seg: seg
306-321 seg

DIISLSSGFDLSGLFX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox