PRGDB00071587 (Nta.6567)

From PRG Wiki
Revision as of 15:09, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Nta.6567
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190812643 (FG169258)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

AGN_RNC004xn13f1.ab1 AGN_RNC Nicotiana tabacum cDNA 5', mRNA sequence

DNA Sequence

TCGGTCCGGATTCCCGGGAttttttttttACAAGTGGTTGTGTGTTCTGTGATATACAGAGCAAGAGAAGTTTGTGGTAGAAGAAGGGAAGTTCGAAAAGGGTGATTTTCTTGTTTTCTAATGGGGATTTGTTTGAGTGCTAGAATTAAAGCTGAAAGCCCATTTCATACAGGGCTAAATTCAAGATCTGTCAGCACAGATGGATATGATAGCAATCCAAGCTCGAGGGTCTCAACCGTGCCACCGGCTCCCAGAAGTGAAGGGGAGATATTGCAGTCGGCCAATTTGAAGAGCTTCAGTTTCTCTGAGCTCAGAACAGCCACTAGGAATTTTCGTCCCGATAGTGTACTGGGAGAAGGTGGATTTGGCTCGGTTTTCAAAGGGTGGATTGACGAGAACACATTTGCAGCTACCAAGCCCGGTACAGGTGTGATCATTGCTGTGAAACGGCTGAATCAAGAAGGTTTTCAAGGTCACAGGGAATGGCTGGCAGAAGTAAACTATTTGGGACAGTTTTCTCATCCTCATCTCGTAAAGTTGATCGGGTATTGCTTGGAGGATGAACACCGGCTTTTGGTTTATGAGTTCATGCCTCGAGGCAGCTTGGAAAACCATTTGTTCAGAAGGGGATCTTATTTCCAGCCTCTATCTTGGAACCTACGATTGAAAGTTGCTCTTGGAGCTGCAAAGGGGCTTGCTTTTCTCCACAGTGCTGAAACCAAAGTGATATATCGAGACTTCAAAACCTCGAATATTTTGCTTGACTCAATTACACTGCCAAGCTCTCGGACTTTGGATTGCAAAGATGGACCACAGTGATAAAAGCCATGTCTCACAGGTATGGGACTATGATATGCAGCTCCAGATACTGCCACTGTCATTACTACAGA


Protein sequences

Name Description Sequence
Nta.6567 translated coding region predicted by ESTScan from UniGene Nta.6567

MGICLSARIKAESPFHTGLNSRSVSTDGYDSNPSSRVSTVPPAPRSEGEILQSANLKSFSFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDSITLPSSRTLDCKDGPQXXKPCLTGMGLXYAAPDTATVITTX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
43-216 Protein kinase-like (PK-like)
Protein kinase-like domain

APRSEGEILQSANLKSFSFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDS

HMMPanther: PTHR24420:SF861
44-216 SUBFAMILY NOT NAMED

PRSEGEILQSANLKSFSFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDS

HMMPanther: PTHR24420
44-216 FAMILY NOT NAMED,FAMILY NOT NAMED

PRSEGEILQSANLKSFSFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDS

Gene3D: G3DSA:3.30.200.20
53-143 no description

SANLKSFSFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGY

ProfileScan: PS50011
IPR000719
71-257 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDSITLPSSRTLDCKDGPQXXKPCLTGMGLXYAAPDTATVITTX

HMMSmart: SM00220
IPR002290
71-255 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDSITLPSSRTLDCKDGPQXXKPCLTGMGLXYAAPDTATVIT

HMMSmart: SM00219
IPR020635
71-253 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDSITLPSSRTLDCKDGPQXXKPCLTGMGLXYAAPDTATV

HMMPfam: PF07714
IPR001245
75-216 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDS

PatternScan: PS00107
IPR017441
77-109 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVFKGWIDENTFAATKPGTGVIIAVK

Gene3D: G3DSA:1.10.510.10
144-216 no description

CLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWNLRLKVALGAAKGLAFLHSAETKVIYRDFKTSNILLDS

Seg: seg
180-193 seg

LRLKVALGAAKGLA

PatternScan: PS00108
IPR008271
202-214 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox