PRGDB00073519 (Pgl.215)

From PRG Wiki
Revision as of 16:08, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.215
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211597004 (GE474165)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ0045.B3.r_P14 GQ004: Non-lignified secondary xylem from mature trees Picea glauca cDNA clone GQ0045_P14 5', mRNA sequence

DNA Sequence

TTGCAGTGACCATCCTGAATATAAGAGCACAGTCCAGTTCAAGATCGATGAATCTTATGCTTGATAGCTTTTCACAGTCCCCGTCCACTGATATGGCTCTAGGAAAACTGGTTATGTTCACACCCAACTCGGATCATGCATCTGAGGATTGGATGACCAGTGCTCATGCATTGATTAACAAAGATTGTGAGCTTGGAAGGGGAGGTTTTGGGACTGTGTACAAAGCAGTCCTAGGGGACGGGAGGATAGTTGCTATAAAGAAGCTGATGGTTTCCAGTTTGGTTAAATCACAAGAAGACTTTGAGAAGGAGATACAGCTTTTGCGTAGAATCAAGCATCCGAATCTAGTGAACTTGCAAGGCTACTACTGGACGCCACAATTACAACTTCTCATATATGACTACATTCAAAGTGGAAGTTTGTATAGTCGACTTCACGAAAGATCCCAAACAGATTCCTCGTTAAGTTGGTCAAGTCGGTTTAATATAGCTTTGGGGACTGCAATGGGGCTTGCACATCTTCACCATGCTTGCAGACCGCCAGTCATACACTATAACATAAAATCCAGCAATATTTTGCTGGATGAGAATTGCAACCCTAAAGTTGCAGATTATGGCCTTGCAAAGTTGCTGCCCATGCTTGATAGATACATTCTAAGTAGCAAAATACAGAGTGCATTAGGATATATGGCACCTGAATTTGCCTGTCAGAGCCTTAAGATAAATGAAAGATGTGATGTCTATGGATTTGGGGTGTTGCTGTTAGAACTTGTTACAGGCAGAAGGCCAGTTGAATACATGGAGGATGAATGTTGTGATCTTATGTGACAATGTGAGGTCATTGCTCGATGAAGGAAAGGCACTGACTTGTGTGGACTCGAGTTTATCTGAATACCCTGG


Protein sequences

Name Description Sequence
Pgl.215 translated coding region predicted by ESTScan from UniGene Pgl.215

XAVTILNIRAQSSSRSMNLMLDSFSQSPSTDMALGKLVMFTPNSDHASEDWMTSAHALINKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCVDSSLSEYPG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF869
2-299 SUBFAMILY NOT NAMED

AVTILNIRAQSSSRSMNLMLDSFSQSPSTDMALGKLVMFTPNSDHASEDWMTSAHALINKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCVDSSLSEYP

HMMPanther: PTHR24420
2-299 FAMILY NOT NAMED,FAMILY NOT NAMED

AVTILNIRAQSSSRSMNLMLDSFSQSPSTDMALGKLVMFTPNSDHASEDWMTSAHALINKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCVDSSLSEYP

superfamily: SSF56112
IPR011009
29-267 Protein kinase-like (PK-like)
Protein kinase-like domain

STDMALGKLVMFTPNSDHASEDWMTSAHALINKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYM

Gene3D: G3DSA:3.30.200.20
48-121 no description

SEDWMTSAHALINKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQG

ProfileScan: PS50011
IPR000719
59-300 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

INKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCVDSSLSEYPG

HMMSmart: SM00220
IPR002290
59-291 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

INKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCV

HMMSmart: SM00219
IPR020635
59-295 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

INKDCELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDECCDLMDNVRSLLDEGKALTCVDSSL

HMMPfam: PF00069
IPR017442
64-266 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ELGRGGFGTVYKAVLGDGRIVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEY

PatternScan: PS00107
IPR017441
65-88 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGTVYKAVLGDGRIVAIKK

Gene3D: G3DSA:1.10.510.10
122-270 no description

YYWTPQLQLLIYDYIQSGSLYSRLHERSQTDSSLSWSSRFNIALGTAMGLAHLHHACRPPVIHYNIKSSNILLDENCNPKVADYGLAKLLPMLDRYILSSKIQSALGYMAPEFACQSLKINERCDVYGFGVLLLELVTGRRPVEYMEDE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox