PRGDB00073522 (Pgl.399)

From PRG Wiki
Revision as of 16:08, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.399
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70638005 (DR573288)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

WS00734.B21_H02 WS-PS-N-A-8 Picea glauca cDNA clone WS00734_H02 3, mRNA sequence

DNA Sequence

ttttttttttttttttttGCGAAAAAAGGTAGTAAAATCTATTACATAGAACGGAATTTAATTTCTAGTCAATCCACTCTGCCAACAACAAATGCTAACACACGGTGAATACAATAAACAACGATGCGTACTGAAAGTTCTACCGGTCTCTATGTACAACACAGGAAGTGAATGATAATTAAAAAAGAATTACTCCGGTTCTGACCAGCTTCGTTCGCTGCTGTTGTCCCCTCCTGGATAGCCATAAATATGCTCATGCTCAGGATAGATCTGCGACTCTTTCGCATCCTCCAACATCCCCAAAACCTCTGCCATCGTCGGCCTCTCAGCCGGAGACAGCGCCACGCAGGAGACCGCTACATTCAGCAGAACCGCTAATTTGTCGTTGCTGGAGTCTTCCGCGGCGGCGTCTCCTTCCATCTCTTGTTCTCGCACGGAGCGTACCCAGCGGTGGAGGTGATCAGTTGAAGAAGAGGGGCCGTGGACAAAGGATGGCAATGGTGTCCTGCCCGTCAGAAGCTCAAGAACGAGAATGCCGAAACTATAGACGTCCGCCTTAGGGCCAAGGGCCGTCATCTTCTTTATTGACTTGCATTCAGGAGCTCTGTAGGCAACGAAGGAACCCTCGCCGTCGCCCTCTCCCTCGCCCTCGCCCTCGCCGTCGGTCGCATTCTCAGTGTGGAAGACCGTGAGGCCGAAGTCTGTGAGGCAAACCTCCATTTCTCTGCCCAACAAGATATTTGATGGGTGGAGATTACCGTGGAAATTATTAGTGAAAGCCCGGTGCAGGTAGGCCAGCCCGTTCGCCACTTCCTTCGCTATCTTCACGCAGGATGTCCAATGCAGCGGCTTCCCACCCGACAAATCACCACTCCCCGTGAATGAAGGAAAAAAGGCTGCCATTGGGCT


Protein sequences

Name Description Sequence
Pgl.399 translated coding region predicted by ESTScan from UniGene Pgl.399

SPMAAFFPSFTGSGDLSGGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHEHIYGYPGGDNSSERSWSEPE

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-221 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SPMAAFFPSFTGSGDLSGGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHEHI

HMMSmart: SM00219
IPR020635
3-206 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MAAFFPSFTGSGDLSGGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGML

HMMSmart: SM00220
IPR002290
5-215 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

AFFPSFTGSGDLSGGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIY

HMMPanther: PTHR24420:SF779
18-219 SUBFAMILY NOT NAMED

GGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHE

HMMPanther: PTHR24420
18-219 FAMILY NOT NAMED,FAMILY NOT NAMED

GGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHE

HMMPfam: PF00069
IPR017442
18-203 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GGKPLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVL

superfamily: SSF56112
IPR011009
21-229 Protein kinase-like (PK-like)
Protein kinase-like domain

PLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHEHIYGYPGGDN

Gene3D: G3DSA:1.10.510.10
21-234 no description

PLHWTSCVKIAKEVANGLAYLHRAFTNNFHGNLHPSNILLGREMEVCLTDFGLTVFHTENATDGEGEGEGEGDGEGSFVAYRAPECKSIKKMTALGPKADVYSFGILVLELLTGRTPLPSFVHGPSSSTDHLHRWVRSVREQEMEGDAAAEDSSNDKLAVLLNVAVSCVALSPAERPTMAEVLGMLEDAKESQIYPEHEHIYGYPGGDNSSERS

Seg: seg
83-96 seg

DGEGEGEGEGDGEG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox