PRGDB00073555 (Pgl.2968)

From PRG Wiki
Revision as of 16:09, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.2968
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211604341 (GE479718)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ0197.B3.r_L17 GQ019: Clean ROOTS systems - P treatments Picea glauca cDNA clone GQ0197_L17 5', mRNA sequence

DNA Sequence

TTTATCTAATCTCATTCATTCAAATCCCTGGCTCTCTCTCCCGCTCTGCATCGGCGTTGGAATTCTTCGTGAATGCGTGTTTGAATCGCTGAATCTAGAGATTTCTCTCTAAATATTCCGACGGGTGCAGAGAAAAAGTCGAACAGAACGGGAGCTTGAATCAGGCTGAATGGAACAGTATGAGAAAGTTGAGAAGATAGGAGAAGGAACATATGGTGTGGTCTACAAGGCCCGTGATCGCTTGACAAATGAGACCATAGCTCTCAAGAAAATTCGTTTGGAGCAAGAAGATGAGGGTGTACCAAGCACTGCAATTAGAGAAATTTCTCTTCTCAAAGAAATGCAACATGGGAACATCGTAAGGTTGCAGGATGTTGTCCACAGTGAAAAACGTCTCTATTTAGTTTTTGAGTATTTGGACTTGGACCTCAAGAAGCATATGGATTCTTGCCCCGAGCTAGCAAAAGATCCTCGTCTAATCAAAACATTTCTGTATCAGATTCTGCGTGGCATTGCCTATTGTCATTCTCATCGAGTTCTTCATCGTGATTTGAAACCACAAAATTTGCTTATTGACCGCAAAACCAATGCGTTGAAACTTGCCGACTTTGGACTTGCAAGGGCATTTGGAATTCCAGTGAGGACCTTTACTCATGAGGTGGTTACATTGTGGTACCGTGCACCAGAGATCTTGCTTGGGTCCCGACATTATTCGACTCCTGTTGATGTTTGGTCTGTGGGGTGTATCTTTGCTGAAATGGTGAATCAGCGACCACTTTTCCCAGGAGACTCAGAGATTGATGAACTCTTTAAGATATTTAGAGTGCTGGGGACACCAAATGAAGAAACATGGCCAGGAGTCACCTCTCTGCCAGACTTTCAGTCAGCCTTCCCAAAGTGGCCAGCCAAGGATTTGGGCACTGTGGTTCCAGGTCTTGAGCCAGCAGGAATTGATCTTCTC


Protein sequences

Name Description Sequence
Pgl.2968 translated coding region predicted by ESTScan from UniGene Pgl.2968

MEQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGIDLL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24056:SF109
1-264 SUBFAMILY NOT NAMED,SHAGGY-RELATED PROTEIN KINASE

MEQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGIDLL

HMMPanther: PTHR24056
1-264 FAMILY NOT NAMED,CELL DIVISION PROTEIN KINASE

MEQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGIDLL

superfamily: SSF56112
IPR011009
1-264 Protein kinase-like (PK-like)
Protein kinase-like domain

MEQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGIDLL

Gene3D: G3DSA:3.30.200.20
2-78 no description

EQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYL

HMMPfam: PF00069
IPR017442
4-232 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVT

ProfileScan: PS50011
IPR000719
4-264 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGIDLL

HMMSmart: SM00219
IPR020635
4-249 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDL

HMMSmart: SM00220
IPR002290
4-261 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKWPAKDLGTVVPGLEPAGI

PatternScan: PS00107
IPR017441
10-33 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTYGVVYKARDRLTNETIALK

Gene3D: G3DSA:1.10.510.10
79-244 no description

VFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEETWPGVTSLPDFQSAFPKW

PatternScan: PS00108
IPR008271
123-135 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKPQNLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox