PRGDB00073638 (Pgl.7376)

From PRG Wiki
Revision as of 16:11, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.7376
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157566046 (EX367274)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

GQ03212.B7_N13 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03212_N13 5', mRNA sequence

DNA Sequence

ACACTTCCAAGTCCCATAGGAAGGCTTTCCAGGTTGACAAATCTAGATTTGCACTCAAATCAATTGTACAGTCTTCCTGATTCAATTGGAGAGCTCTCAAGCCTGACTGATCTAGATTTACATGGCAACCGCTTGAGGGCTTTGCCTGCCTCAATTGGGGATCTTTCCGGTCTTACAAATCTTAACCTGAGTGCAAACCAGCTGTCCTCATTACCAGAGTCTATTGGGAAGCTGGCCAACTTGAAAAGGCTAAATGTAGAGGCAAATGAGATAGAGGAACTGCCATATACAATTGGCCAATGTACTGCTCTCATTGAGCTGCGAGCGGATTTCAATCACCTCAAAGCATTGCCAGAAGCAGTTGGAAAGCTTGTGTCTTTAGAGGTCCTAACACTGCACTATAACAGAATAAAGAGCCTGCCAACTACTATGGCTTCTTTATCGAGTTTGAAAGAACTTGATGTGAGCTTCAACGAATTGGAGTCAATACCTGAAAGCTTGTGCTTTGCTACTAGTCTTGTCAAACTGAACGTTGGCAGGAACTTTGCCGACTTGCACTCTCTTCCCCGGTCCATAGGCAATCTTGAAATGCTTGAGGAGTTAGATATTAGTAGCAATCAGATAAAGGTTCTGCCGGATTCTTTTGCTATGCTTAATAAACTTCGCCTGCTTACAGTGGAAGAGACCCCTCTTGAAGAACCTCTAAGGCATATAGCTGAAATGGGAGCTCAGGCTGTTGTGCAGTACATGAAGGAACAAATTGCTAAGAGGGAAGAAGAATCACAAGTTACTAAGCCCAAGGGCAGGTGGTCAAAATTTCTATCATGTCTGCTAGTTTTGACTGGGAAGCGAAGAAGCAGAGGCTATGCCAAAGCTTTGACAGGATTGCTACAGAATGAATTTCTGGCATGGAATCGCA


Protein sequences

Name Description Sequence
Pgl.7376 translated coding region predicted by ESTScan from UniGene Pgl.7376

TLPSPIGRLSRLTNLDLHSNQLYSLPDSIGELSSLTDLDLHGNRLRALPASIGDLSGLTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELPYTIGQCTALIELRADFNHLKALPEAVGKLVSLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIPESLCFATSLVKLNVGRNFADLHSLPRSIGNLEMLEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEEPLRHIAEMGAQAVVQYMKEQIAKREEESQVTKPKGRWSKFLSCLLVLTGKRRSRGYAKALTGLLQNEFLAWNRX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-241 L domain-like,LRR

TLPSPIGRLSRLTNLDLHSNQLYSLPDSIGELSSLTDLDLHGNRLRALPASIGDLSGLTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELPYTIGQCTALIELRADFNHLKALPEAVGKLVSLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIPESLCFATSLVKLNVGRNFADLHSLPRSIGNLEMLEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEEPLRHIAEM

HMMPanther: PTHR23155:SF267
2-254 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LPSPIGRLSRLTNLDLHSNQLYSLPDSIGELSSLTDLDLHGNRLRALPASIGDLSGLTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELPYTIGQCTALIELRADFNHLKALPEAVGKLVSLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIPESLCFATSLVKLNVGRNFADLHSLPRSIGNLEMLEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEEPLRHIAEMGAQAVVQYMKEQI

HMMPanther: PTHR23155
2-254 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LPSPIGRLSRLTNLDLHSNQLYSLPDSIGELSSLTDLDLHGNRLRALPASIGDLSGLTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELPYTIGQCTALIELRADFNHLKALPEAVGKLVSLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIPESLCFATSLVKLNVGRNFADLHSLPRSIGNLEMLEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEEPLRHIAEMGAQAVVQYMKEQI

Gene3D: G3DSA:3.80.10.10
2-111 no description

LPSPIGRLSRLTNLDLHSNQLYSLPDSIGELSSLTDLDLHGNRLRALPASIGDLSGLTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELPYTIGQCTALIELRADF

HMMSmart: SM00364
9-28 Leucine-rich repeats, bacterial type

LSRLTNLDLHSNQLYSLPDS

HMMSmart: SM00369
IPR003591
9-30 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSRLTNLDLHSNQLYSLPDSIG

HMMPfam: PF13504
10-26 LRR_7,Leucine rich repeat

SRLTNLDLHSNQLYSLP

ProfileScan: PS51450
IPR001611
11-32 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTNLDLHSNQLYSLPDSIGEL

HMMSmart: SM00369
IPR003591
32-54 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTDLDLHGNRLRALPASIGD

HMMSmart: SM00364
32-51 Leucine-rich repeats, bacterial type

LSSLTDLDLHGNRLRALPAS

HMMPfam: PF13504
33-49 LRR_7,Leucine rich repeat

SSLTDLDLHGNRLRALP

ProfileScan: PS51450
IPR001611
34-55 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLDLHGNRLRALPASIGDL

HMMSmart: SM00369
IPR003591
55-77 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSGLTNLNLSANQLSSLPESIGK

HMMSmart: SM00364
55-74 Leucine-rich repeats, bacterial type

LSGLTNLNLSANQLSSLPES

ProfileScan: PS51450
IPR001611
57-78 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTNLNLSANQLSSLPESIGKL

FPrintScan: PR00019
58-71 LEURICHRPT,Leucine-rich repeat signature

LTNLNLSANQLSSL

Seg: seg
58-71 seg

LTNLNLSANQLSSL

HMMPfam: PF12799
58-95 LRR_4,Leucine Rich repeats (2 copies)

LTNLNLSANQLSSLPESIGKLANLKRLNVEANEIEELP

HMMSmart: SM00364
78-97 Leucine-rich repeats, bacterial type

LANLKRLNVEANEIEELPYT

HMMSmart: SM00369
IPR003591
78-101 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LANLKRLNVEANEIEELPYTIGQC

ProfileScan: PS51450
IPR001611
80-101 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLNVEANEIEELPYTIGQC

HMMSmart: SM00364
101-120 Leucine-rich repeats, bacterial type

CTALIELRADFNHLKALPEA

Gene3D: G3DSA:3.80.10.10
112-234 no description

NHLKALPEAVGKLVSLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIPESLCFATSLVKLNVGRNFADLHSLPRSIGNLEMLEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEEP

HMMSmart: SM00369
IPR003591
124-146 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVSLEVLTLHYNRIKSLPTTMAS

HMMSmart: SM00364
124-143 Leucine-rich repeats, bacterial type

LVSLEVLTLHYNRIKSLPTT

ProfileScan: PS51450
IPR001611
126-147 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLTLHYNRIKSLPTTMASL

HMMPfam: PF12799
126-164 LRR_4,Leucine Rich repeats (2 copies)

SLEVLTLHYNRIKSLPTTMASLSSLKELDVSFNELESIP

FPrintScan: PR00019
147-160 LEURICHRPT,Leucine-rich repeat signature

LSSLKELDVSFNEL

HMMSmart: SM00369
IPR003591
147-170 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLKELDVSFNELESIPESLCFA

HMMSmart: SM00364
147-166 Leucine-rich repeats, bacterial type

LSSLKELDVSFNELESIPES

ProfileScan: PS51450
IPR001611
149-170 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKELDVSFNELESIPESLCFA

HMMSmart: SM00364
195-214 Leucine-rich repeats, bacterial type

LEMLEELDISSNQIKVLPDS

HMMSmart: SM00369
IPR003591
195-217 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEMLEELDISSNQIKVLPDSFAM

ProfileScan: PS51450
IPR001611
197-218 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLEELDISSNQIKVLPDSFAML

HMMPfam: PF12799
198-233 LRR_4,Leucine Rich repeats (2 copies)

LEELDISSNQIKVLPDSFAMLNKLRLLTVEETPLEE

Seg: seg
221-236 seg

LRLLTVEETPLEEPLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox