PRGDB00073850 (Pgl.22771)

From PRG Wiki
Revision as of 16:17, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.22771
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157504694 (EX305925)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ01301.B7_K09 GQ013 - Elongating ROOTS tips - sapplings Picea glauca cDNA clone GQ01301_K09 3', mRNA sequence

DNA Sequence

TTTTTTCGAGTTGGATATTACGCTCATAAAGAAGCTATTTATCATTGTGGCATACACGCACAAAATCAGAAGAAACCCATTTTGTGTCAACAACCGCTTCGAGGAGTGAGCTGGCAAGCGACGTAAAACTCTGTATACGAGAGCAATAATGTCAAACTTTCCCAAGAGAAAGCGACACAAACAGACAAGAGTTGGTGTATCTTTCCATCATTATCATCGTCATTCTACGCCTCACCAGGGCGCTTTGAATTACAAGACACAATCTTGATCTTGTCGGTCGTAACGCTGGGTGTATTTCCACCCTGCTGCTGAAATTTGAAGGTGACATTTTTGATGAGGAAAGTCCACACCTCGTCGCAGAAACGGTATGTATCGAGGTTTCCCTTGAAGGTCAAGTTTGCCTTGACCTTCTCCGACAGCACTTCGGTGACATGCCTATCAAAGTTGTTGAGGATTTTCATAGCCAACTGTGGTGCGATGCGGCCCTCGGAAATCAAATCATCGAGCGCATCAGTAAGTGCCATACCAATCGAGGATCGCCTGTAAAGCTCATAGTATGGATTCTGAGGTGTTGCCATCTTATCGAATGGTATATTCGCGGTGGATAAGTGTTGCGTATTTCAGCAGTGAGCTTGATGAATCTCTAGTAATGGTTTGCGAGATGGATGATCAATGAGCTGCTAGCCTTAAGCGATGGAGAACTGACTCAGTGTATAAAATGAACTTCGGTTCGCTAAGTTCAGAATGT


Protein sequences

Name Description Sequence
Pgl.22771 translated coding region predicted by ESTScan from UniGene Pgl.22771

MATPQNPYYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLSEKVKANLTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNSKRPGEA

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF009415
IPR003194
4-117 Transcription initiation factor IIA, gamma subunit
Transcription initiation factor IIA, gamma subunit

PQNPYYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLSEKVKANLTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNSKRPGEA

Gene3D: G3DSA:1.10.287.190
IPR015872
6-59 no description
Transcription initiation factor IIA, gamma subunit

NPYYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLSEKVK

HMMPanther: PTHR10966
IPR003194
7-116 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

PYYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLSEKVKANLTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNSKRPGE

HMMPfam: PF02268
IPR015872
8-55 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

YYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLS

BlastProDom: PD009224
IPR015872
8-54 Q4WZV0_ASPFU_Q4WZV0;
Transcription initiation factor IIA, gamma subunit

YYELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVL

superfamily: SSF47396
IPR009083
9-59 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

YELYRRSSIGMALTDALDDLISEGRIAPQLAMKILNNFDRHVTEVLSEKVK

HMMPfam: PF02751
IPR015871
57-111 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKANLTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNS

superfamily: SSF50784
IPR009088
57-112 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKANLTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNSK

Gene3D: G3DSA:2.30.18.10
IPR009088
62-116 no description
Transcription factor IIA, beta-barrel

LTFKGNLDTYRFCDEVWTFLIKNVTFKFQQQGGNTPSVTTDKIKIVSCNSKRPGE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox