PRGDB00073879 (Pgl.24285)

From PRG Wiki
Revision as of 16:18, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.24285
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157567389 (EX368617)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

GQ03214.B7_I17 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03214_I17 5', mRNA sequence

DNA Sequence

CTGCTGTTAAAGGAGAATAATGCTATTGAAGAAGTTCCTGAAAACTTCCTGCGCGAGTTGTCTTCACTGAAGGTCCTCGATCTTCGTGAGACTCGCATAGTGTCTCTGCCCCCTTGTATTGCAAATCTGAAACATCTTGCCTCCCTCCAGCTAACTTACTGCCAGAAGATCCGTGAATTGCCGGAAGCCATTTGCGACCTGAAGGAGCTTCAATTCCTGGATGTTAGTCACTGTAAGAAATTACAGTGCCTTCCGGAGAGGATAAGTGAGCTCAAAAGTTTGAGAGCCCTCGACATAAGCTATTGCCCAAAGTTGAGACATCTTCCACGTGGCATCTCGGAATTGGTTAAACTGGAAAGATTGGCGATGATGGTCAGCTGCAACATTCGATTGAATTTCGAAGAGGAGGCAAATGCGGAGGAAAAAAAGTATGGTTGTTTAAAGGACCTGCAAAGTTTGTGCCGTCTCAGGCTTCTCCATGTCGAAATAAAGTCGCCAGTCAAGGACGGGGTTATGGGAAATTGGTCAAATATGAGAGATCTGTCGCTGGATTTTTGGGGTGCGAATCAAGATTACCTTCCGCAGGATATGCAGGATATGCAGCATCTGGAAAGTTTCACTCTTTCTAAATGCGATGTGAAGCGACTGCCTGGATGGGTTAGTGATTTCCGAAAGCTCGCATACCTTAAACTTAGTATTTGTGAGCAGTTGAAAGAGCTCCCGGCGGAGTTTCCATGTTTGAGAGTGCTTCGGATGGAAATTTGCGATAAGTTGGAGAAGTTGGAGTTGGGGATGGGTTTTCCAAAGCTACAGAAGTTGAGTCTGTGGATGTTAGAGTCGTTGGAGTGTGTGGGGGCGTCACCGTTACCCCCCATGCTCAAGTCTGTCGATGTAACTGGATGTC


Protein sequences

Name Description Sequence
Pgl.24285 translated coding region predicted by ESTScan from UniGene Pgl.24285

LLLKENNAIEEVPENFLRELSSLKVLDLRETRIVSLPPCIANLKHLASLQLTYCQKIRELPEAICDLKELQFLDVSHCKKLQCLPERISELKSLRALDISYCPKLRHLPRGISELVKLERLAMMVSCNIRLNFEEEANAEEKKYGCLKDLQSLCRLRLLHVEIKSPVKDGVMGNWSNMRDLSLDFWGANQDYLPQDMQDMQHLESFTLSKCDVKRLPGWVSDFRKLAYLKLSICEQLKELPAEFPCLRVLRMEICDKLEKLELGMGFPKLQKLSLWMLESLECVGASPLPPMLKSVDVTGCX


Domains

Domain Start-End Description Sequence

HMMPfam: PF13855
2-54 LRR_8,Leucine rich repeat

LLKENNAIEEVPENFLRELSSLKVLDLRETRIVSLPPCIANLKHLASLQLTYC

Gene3D: G3DSA:3.80.10.10
5-275 no description

ENNAIEEVPENFLRELSSLKVLDLRETRIVSLPPCIANLKHLASLQLTYCQKIRELPEAICDLKELQFLDVSHCKKLQCLPERISELKSLRALDISYCPKLRHLPRGISELVKLERLAMMVSCNIRLNFEEEANAEEKKYGCLKDLQSLCRLRLLHVEIKSPVKDGVMGNWSNMRDLSLDFWGANQDYLPQDMQDMQHLESFTLSKCDVKRLPGWVSDFRKLAYLKLSICEQLKELPAEFPCLRVLRMEICDKLEKLELGMGFPKLQKLSL

HMMPanther: PTHR23155
6-301 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NNAIEEVPENFLRELSSLKVLDLRETRIVSLPPCIANLKHLASLQLTYCQKIRELPEAICDLKELQFLDVSHCKKLQCLPERISELKSLRALDISYCPKLRHLPRGISELVKLERLAMMVSCNIRLNFEEEANAEEKKYGCLKDLQSLCRLRLLHVEIKSPVKDGVMGNWSNMRDLSLDFWGANQDYLPQDMQDMQHLESFTLSKCDVKRLPGWVSDFRKLAYLKLSICEQLKELPAEFPCLRVLRMEICDKLEKLELGMGFPKLQKLSLWMLESLECVGASPLPPMLKSVDVTGC

superfamily: SSF52058
6-301 L domain-like,LRR

NNAIEEVPENFLRELSSLKVLDLRETRIVSLPPCIANLKHLASLQLTYCQKIRELPEAICDLKELQFLDVSHCKKLQCLPERISELKSLRALDISYCPKLRHLPRGISELVKLERLAMMVSCNIRLNFEEEANAEEKKYGCLKDLQSLCRLRLLHVEIKSPVKDGVMGNWSNMRDLSLDFWGANQDYLPQDMQDMQHLESFTLSKCDVKRLPGWVSDFRKLAYLKLSICEQLKELPAEFPCLRVLRMEICDKLEKLELGMGFPKLQKLSLWMLESLECVGASPLPPMLKSVDVTGC

HMMPfam: PF00560
IPR001611
70-90 LRR_1
Leucine-rich repeat

LQFLDVSHCKKLQCLPERISE

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

SLRALDISYCPKLRHLPRGISE

Seg: seg
132-143 seg

NFEEEANAEEKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox