PRGDB00073971 (Ppa.129)

From PRG Wiki
Revision as of 16:20, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppa.129
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 33591209 (AY339068)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens shaggy-related protein kinase 4 (SK4) mRNA, complete cds

DNA Sequence

ACTTCTATGGCATCTTCTACTGCCGGTGCTGTTAGTGGCACAAATATGATAGGAGGTGGAAGAGCGGCTCCAACTAAAGCAGGTTCTAGTGGCGTGGAGTTATTACCCAAAGAGATGCACGAGATGAAGCTAAGGGATGATAAGGTTGACCACGGCGATGATAAGGAGATTGAAGCAACAGTAGTTGATGGAAATGGCACCGAGACAGGCCACATCATAGCTACCACTATTGGAGGACGCAATGGCCAACCGAAGCAGACCATCAGTTACTCGGCGGAACGTGTTGTAGGTACAGGATCGTTTGGGATCGTGTTTCAGGCTAAATGCATTGAGAGCGGGGAGACGGTGGCCATAAAGAAGGTGCTCCAAGACAAGAGATACAAGAATCGAGAGCTCCAGATCATGAGGCTATTGGATCATCCTAATATTGTAGCTCTGAAGCACTGCTTCTTTTCTACAACTGAGAAGGATGAGCTGTATTTGAACTTGGTTCTGGAGTACGTCCCGGAGACGGTTTATCGTATTGCAAAGCACTACAATCGTATGAACCAGAGAATGCCGCTGGTTTATGTGAAGCTGTACACTTATCAGATATGCCGGTCACTGGCGTACATTCACAGCGGCATTGGAGTATGCCATCGTGATATCAAGCCCCAGAACCTGCTGGTGAATCCCCACACGCATCAGCTAAAGCTATGCGACTTTGGAAGTGCGAAAGTTTTGGTGAAAGGGGAGCCTAATATTTCGTACATTTGTTCACGATATTACCGTGCTCCCGAGCTGATATTTGGAGCTACAGAATACACAACTGCGATTGACATATGGTCGATGGGTTGCGTGATGGCGGAACTTCTCCTAGGACAGCCTTTGTTCCCTGGAGAAAGCGGAGTTGATCAATTGGTGGAGATCATCAAGGTGTTAGGGACACCTACACGTGAGGAGATAAAGTGCATGAATCCGAACTACACGGAGTTCAAGTTTCCTCAAATTAAGGCTCACCCGTGGCACAAGGTTTTCCACAAACGCATGCCTTCAGAAGCAGTGGACCTGGTTTCAAGACTGCTACAGTACTCCCCAAATCTGCGGTGCAACGCTTTGGAAGCTTGCGTGCATCCGTTTTTTGACGAGCTTCGGGACCTCAACTGCCGTTTACCAAATGGGCGGCCACTTCCCCCGTTGTTCAACTTCAAACCTCAAGAGTTGAAAGGTGCTACTCCTGAGATTCTGCAACGGTTGATACCTGAGCATGCAAGGAAGCAAAACCCGATGCTCGCGTTGTAAGCGCTGGTTTGGAGGCAATTGAAAGGCCTTGTTTTTAAGGGGTTTCCCTGCTTAGAGAACCGGGCAACTATGTGCACAGACATAGTTGAAATTGCGTCTTTTCTGGTTTGATAGCATTCGGTGCCCAGTCTGATTAGGTCCCCTGCTTTTCATACGCTGTGTAAGGGAGACAGAGTAGACTTTAAGCATGTCGCTGTTACGGACAGGTAAATATGGGAGAGTACAGTGTGCATGCATGTCTATGCCAGGTGCGCATGTAAGTGTATCCTAATGTTTCTGGGAGTGCATTGAGGTGCGCGGCAATTGGAAGGGTAAGGAGCGGAGATATTAGGTGTAGAGAGGCTCAGTCGGGCTGTTACATATAGGGGCCCGGCTGGTGCTAGAAGTTAGCGAGTTAAACGGAACGTTGTTATTTAGGAGCAGAAGTAGAATGTAATTTGGGTAGAAGATGGAAGTTCGAAATGTGATTTTATCATCCGGATATTTGTATACTCTGCNTGGGTGGAGAATGCCCTATGTGTACTCCTAAAATCCTCCNCGANGGTCTCCCAGA


Protein sequences

Name Description Sequence
Ppa.129 translated coding region predicted by ESTScan from UniGene Ppa.129

TSMASSTAGAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDDKEIEATVVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDLNCRLPNGRPLPPLFNFKPQELKGATPEILQRLIPEHARKQNPMLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24057
6-421 FAMILY NOT NAMED,GLYCOGEN SYNTHASE KINASE-3 ALPHA

STAGAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDDKEIEATVVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDLNCRLPNGRPLPPLFNFKPQELKGATPEILQRLIPEHARKQN

Gene3D: G3DSA:3.30.200.20
84-165 no description

PKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVL

superfamily: SSF56112
IPR011009
89-405 Protein kinase-like (PK-like)
Protein kinase-like domain

SYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFFDELRDLNCRLPNGRPLPPLFNFKPQELKGAT

ProfileScan: PS50011
IPR000719
90-374 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMSmart: SM00220
IPR002290
90-374 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMSmart: SM00219
IPR020635
90-374 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFF

HMMPfam: PF00069
IPR017442
91-374 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLEYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFF

PatternScan: PS00107
IPR017441
96-120 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGTGSFGIVFQAKCIESGETVAIKK

Gene3D: G3DSA:1.10.510.10
166-378 no description

EYVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPSEAVDLVSRLLQYSPNLRCNALEACVHPFFDELR

PatternScan: PS00108
IPR008271
211-223 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDIKPQNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox