PRGDB00074260 (Ppa.17582)

From PRG Wiki
Revision as of 16:28, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppa.17582
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 162194321 (FC371078)
Gene Class Unknown
Domain Type
Gene Species Physcomitrella patens

Comment?

CAYY7343.fwd CAYY Physcomitrella patens subsp. patens Villersexel - regular (H) Physcomitrella patens subsp. patens cDNA clone CAYY7343 5', mRNA sequence

DNA Sequence

GGAGGATACATTGAAGGAGACATAAGGGTGTCTGGGTATCCCAAGATTCAGGAAACATTTGCACGTATATCAGGCTATGTAGAGCAGACCGATATTCATTCTCCACAAGTGACCGTTTACGAATCATTAGCATACTCATCTTGGCTTCGGCTACCTAAGGACGTTGATCCTGAAACTCGAAAGTTCTTCGTGGAGGAAGTCATGGAGTTGGTCGAGTTGAACAGCTTAAGACAATCTCTTGTAGGACTCCCTGGTAGCACTGGACTTTCGACAGAACAACGGAAGCGCCTGACTATTGCCGTTGAACTAGTTGCCAACCCGTCCATTATCTTTATGGATGAACCTACGTCAGGATTGGATGCCCGTGCAGCAGCAATCGTAATGCGCACTGTTCGAAACACAGTGGATACAGGGAGGACAGTCGTTTGCACCATTCATCAGCCTAGCATAGACATTTTTGAGGCATTTGATGAGCTTCTACTTTTGAAACGTGGTGGACAAACAGTGTACGCTGGGCAACTTGGTCCACAATCAAAAAATTGGTTGAATACTTCCAGGCCATTGAGGGAACTCCTCCCATCAAAGAAGGGTATAATCCAGCTACATGGATGCTGGAAGTCACAACTTCAGGAGAAGAGTTGCGCACTGGCAAAGATTTTGCAGACATCTACAGAGATTCGAATCTGTTTCGGCAAAATGAAGAGATGATAACGAGGTTAAGTGTCCCCAAAGCTGGATCTCATGACCTCGAGTTCTCGACTCAATTCTCACGATCTTCTTGGACACAGTTCAAAGCGTGTTTATGGAAGCAAAACTTGACATATTGGCGCAGTCCTTATTATAACGCTGTGCGC


Protein sequences

Name Description Sequence
Ppa.17582 translated coding region predicted by ESTScan from UniGene Ppa.17582

GGYIEGDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQTVYAGQLGPQSXKLVEYFQAIEGTPPIKEGYNPATWMLEVTTSGEELRTGKDFADIYRDSNLFRQNEEMITRLSVPKAGSHDLEFSTQFSRSSWTQFKACLWKQNLTYWRSPYYNAVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
1-285 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GGYIEGDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQTVYAGQLGPQSXKLVEYFQAIEGTPPIKEGYNPATWMLEVTTSGEELRTGKDFADIYRDSNLFRQNEEMITRLSVPKAGSHDLEFSTQFSRSSWTQFKACLWKQNLTYWRSPYYNAVR

HMMPanther: PTHR19241
1-285 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GGYIEGDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQTVYAGQLGPQSXKLVEYFQAIEGTPPIKEGYNPATWMLEVTTSGEELRTGKDFADIYRDSNLFRQNEEMITRLSVPKAGSHDLEFSTQFSRSSWTQFKACLWKQNLTYWRSPYYNAVR

superfamily: SSF52540
3-176 P-loop containing nucleoside triphosphate hydrolases

YIEGDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQTVYAGQLGP

Gene3D: G3DSA:3.40.50.300
5-173 no description

EGDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQTVYAGQ

HMMPfam: PF00005
IPR003439
6-117 ABC_tran
ABC transporter-like

GDIRVSGYPKIQETFARISGYVEQTDIHSPQVTVYESLAYSSWLRLPKDVDPETRKFFVEEVMELVELNSLRQSLVGLPGSTGLSTEQRKRLTIAVELVANPSIIFMDEPTS

Seg: seg
64-73 seg

VEEVMELVEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox