PRGDB00074265 (Ppa.18093)

From PRG Wiki
Revision as of 16:29, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppa.18093
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 168048784 (XM_001776794)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Physcomitrella patens

Comment?

Physcomitrella patens subsp. patens predicted protein (PHYPADRAFT_221343) mRNA, complete cds

DNA Sequence

GAGGAAGTGATGAGGAAGGTGGGGAAGTATGAAGTGGGGCGGACAATTGGCGAAGGCACCTTTGCTAAAGTCAAATTCGCCATCAACACCGAAACGAGCGAATTTTTGGCGATGAAGGTGTTGGATAAAGATACCGTGCTGAGGAATAAGATGGTGGAGCAGATCAAGCGTGAGATATCCATAATGAAGATGATTAGACATCCCAATGTGGTGCGCTTGCATGAGGTGCTGGCCAGCCGAGCGAAGATCTACATCGTACTGGAGTTTGTTTCTGGTGGAGAATTGCTGGATACAATTGCACACAAAGGGAGACTCAGTGAGGGGCATTCTCGTAGGTACTTCCAGCAACTGATAGATGCAGTTGCATATTGTCACAGCAAGGGTATATCGCACCGAGACTTGAAGCCAGAGAATCTGCTATTGGATGCTAAGGGAAACTTGAAAGTTTCGGATTTTGGGCTCAGTGCACTGCCGCATCAAGAAGATGGCCTTTTGCACACAACTTGTGGCACTCCCAACTATGTTGCTCCGGAGGTGCTTGACAACAATGGCTACGACGGTGCAGTGGCGGACATTTGGTCATGTGGTGTAATCCTTTTCGTTTTGATGGCGGGATATCTTCCATTCAATGAAGCCGACCTTAAAACTCTTTATGAGAAGATTCAACATGCAAGTTTCTTATGTCCTGCCTGGTTCTCACCTGGCGCCAAGTCATTGATATTGAAGATGCTGGACCCCAATACTCGAACTCGCATTACTTTAGAGGGGATTTATAACCACCCGTGGTTTAAAAAGAACTACGTTCCCGCGCGTTTGAGCGATGCTGAAGAGGCTTCAGATCTTGATGATGTGGAGTCTGTCTTTGATAATTCAGAGGAACGATTCGTTGATGATCAACTGGTCAAAGAATCAGGACCTTCCATGATGAATGCATTTGAACTCATAACACTCTCTCAGGGATTGAATCTCTCCGCTCTGTTTGATAGGCGACAGGATCATGTGAAACGTCAAACATGTTTTACTTCAAATATACCGGCTAACGAAATTATTTCTCGAATGGAAGGAGCTGCCCAATCGATGGGCTTTCGAGTGGAAACTCGCAAATACAAGATGAGGCTTGAAGGTCGTGGTGGTGGCAAGATTAATCAGCACTTGGCCGTGGCCATTGAGGTGTTCGAGATGGCGCCTTCCGTGTTCATGATTGAGGTGCGGAAAGCCATGGGTGATACTTTGGAATATCACAAGTTCTATAAAACTTTCTGTGACCGAATGAAGGACGTTACCTCCAAAATGCCGACGTTGGGAATTGATCGAGGAAAACAACTTGCACCTTGAGCATAGAAGTGTGTGTGTATGGTGAACTACAAGAAACGAATGTGTAAGTATTTTTGTGGAGTTGAGGTGTGTGGTTATGCTGGTTTACTTTTAGGCTGACAAGATTTGAACAACACTAGAACAGGACTAAAGGTGTCTGATCCAATTAGTGGAACACACAGTTGGAAATTGTTGTATGATGTAGGCACATTCTGTAAAAAAGAACAGTTGGT


Protein sequences

Name Description Sequence
Ppa.18093 translated coding region predicted by ESTScan from UniGene Ppa.18093

EEVMRKVGKYEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEERFVDDQLVKESGPSMMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVETRKYKMRLEGRGGGKINQHLAVAIEVFEMAPSVFMIEVRKAMGDTLEYHKFYKTFCDRMKDVTSKMPTLGIDRGKQLAP

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-294 Protein kinase-like (PK-like)
Protein kinase-like domain

EEVMRKVGKYEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEER

HMMPanther: PTHR24344:SF45
4-417 SUBFAMILY NOT NAMED

MRKVGKYEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEERFVDDQLVKESGPSMMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVETRKYKMRLEGRGGGKINQHLAVAIEVFEMAPSVFMIEVRKAMGDTLEYHKFY

HMMPanther: PTHR24344
4-417 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE CDS1

MRKVGKYEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEERFVDDQLVKESGPSMMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVETRKYKMRLEGRGGGKINQHLAVAIEVFEMAPSVFMIEVRKAMGDTLEYHKFY

Gene3D: G3DSA:3.30.200.20
5-106 no description

RKVGKYEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLS

HMMPfam: PF00069
IPR017442
10-263 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWF

ProfileScan: PS50011
IPR000719
10-263 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWF

HMMSmart: SM00219
IPR020635
10-263 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWF

HMMSmart: SM00220
IPR002290
10-263 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGRTIGEGTFAKVKFAINTETSEFLAMKVLDKDTVLRNKMVEQIKREISIMKMIRHPNVVRLHEVLASRAKIYIVLEFVSGGELLDTIAHKGRLSEGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWF

PatternScan: PS00107
IPR017441
16-39 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTFAKVKFAINTETSEFLAMK

Gene3D: G3DSA:1.10.510.10
107-286 no description

EGHSRRYFQQLIDAVAYCHSKGISHRDLKPENLLLDAKGNLKVSDFGLSALPHQEDGLLHTTCGTPNYVAPEVLDNNGYDGAVADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNTRTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVES

PatternScan: PS00108
IPR008271
129-141 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ISHRDLKPENLLL

ProfileScan: PS50816
IPR018451
304-328 NAF
NAF/FISL domain

SGPSMMNAFELITLSQGLNLSALFD

HMMPfam: PF03822
IPR004041
306-365 NAF
NAF domain

PSMMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox