PRGDB00074298 (Ppe.5958)

From PRG Wiki
Revision as of 16:30, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.5958
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209174457 (FC861697)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN033D08-T7 PPN Prunus persica cDNA clone PPN033D08, mRNA sequence

DNA Sequence

GAGCACCCCATTTACGAGGATGCTGGTTTTTGAATATGCTTCAAATGGGACACTGTATGAGCACCTCCATTATGGAGAAGGATGCCAGTTAAGTTGGACACGGCGCATGAAAATTGTTATAGGAATTGCTCGGGGACTTAAGTATTTTCACACAGAGCTTGAGCCACCATTTACCATATCCGAGTTAAATTCTAGTGCTGTATATCTTACAGAAGATTTTTTACCCAAGCTGGTAGATTTTGAGAGTTGGAAGACAATTCTGGCGAGGTCAGAAAAGAACTCAGGCTCTATTAGCAGCCAAGGTGCTATTTGTGTTCTTCCAAATTCTATGGGAGCACGCCACCTGGATGTTAAAGGCAATGTTTATGCTTTTGGCATACTTTTGCTCGAAGTAATCAGTGGTAGGCCTCCCTACTGCAAGGACAAAGGGTGCTTGATAGAATGGGCCAAAGACTATCTTGAGTTGCCAGATGTGATGCCTTATGTGGCGGATCCTGAACTGAAACATTTCAGTTACGACGACCTCAAAGTTTTATGTGATGTGGTGAATCTTTGCACCCATCCAGAGCCCACGAAGCGGCCTTCCATGCAGGAAATATGCACCATGTTGGAGAGCAGAATCGACACATCGGTGTCTATTGAGCTCAAGGCATCTTCTTTGGCATGGGCCGAGCTTGCACTTTCATCATAATGAGTAAAATTNACACACTGTA


Protein sequences

Name Description Sequence
Ppe.5958 translated coding region predicted by ESTScan from UniGene Ppe.5958

XSTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRIDTSVSIELKASSLAWAELALSS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-208 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

HMMPanther: PTHR24420:SF812
4-208 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

PFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

HMMPanther: PTHR24420
4-208 FAMILY NOT NAMED,FAMILY NOT NAMED

PFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

superfamily: SSF56112
IPR011009
5-204 Protein kinase-like (PK-like)
Protein kinase-like domain

FTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

HMMPfam: PF07714
IPR001245
7-204 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

RMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

Gene3D: G3DSA:1.10.510.10
15-204 no description

SNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMGARHLDVKGNVYAFGILLLEVISGRPPYCKDKGCLIEWAKDYLELPDVMPYVADPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

Seg: seg
216-230 seg

LKASSLAWAELALSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox