PRGDB00074303 (Ppe.7139)

From PRG Wiki
Revision as of 16:30, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.7139
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84631944 (DW345554)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PP_LEc0023N11f Peach shoot Prunus persica cDNA clone PP_LEc0023N11f, mRNA sequence

DNA Sequence

TCCAATTTCTGGGCTTATTACATTCTCCTTGGATAAATAAAAAATTAAATATTTTATAAGAATGGTAATATTTTACAGGATTTAATCATACATGAAGACCTACAACATATAACAAAAATCCACGAGGGAAACATTCAAAATAACAAGTTCAAAAAAATTTCTCTCTTAATATAAGTCTCCGTCACACACAATTTAAGAAGAGGAGACCCAGTCAACCTCCTAACCCAACCAGTCAACGCGCCAAACAGTACTCACTGTTTCCTCCGACTCCGTCTGACTCCTCCTCCTCCATGTTCGTGATTCAAACTGTCGCCCAAAAACGTCTTTGCCGCGTCCAAACTCGGAAAATAAGTCGGCTCCAAGAATATCTGACTCAGTGAGTCACATATCTCCGTACTCACCACGACTCGGTTTCCCTTCGCTTCCAAGCTACCCATCAAAACCACCAGCACCTGTTTGTACGCGTAGTAGAACCGCTTCAGCGCCGACTCAATCGCCTGAAGCGCCTGCAGCACGTGGATCTTCTCCGAGTCCGAATCCGATCCGATCTTCTTCTCCGAATACAACCTCATCGCCGCCTCCTGAATCCTGGGCCCACCCTTGGGGTCCACCTCAACATCCAAGATGTACGGCACCCTGTGCCTCAACTCCTTACAAAGCTTCGTCACGTCCACCAGCCCCTTCGATCTGAAGCAAAACGACTCCGTATCGTCCACCGTCTTGATGCTGAGCTGGTTCTTCAGCCTCAGAAAATCGTCCGGGTCCATCAGAAGGTGGAGATCTTCGATCTCCGCCAGAAGCTTCCATATCCGTTCGATCAGGTAACAGTCACTAGCGGCTTTTTCGAAGTCTCT


Protein sequences

Name Description Sequence
Ppe.7139 translated coding region predicted by ESTScan from UniGene Ppe.7139

RDFEKAASDCYLIERIWKLLAEIEDLHLLMDPDDFLRLKNQLSIKTVDDTESFCFRSKGLVDVTKLCKELRHRVPYILDVEVDPKGGPRIQEAAMRLYSEKKIGSDSDSEKIHVLQALQAIESALKRFYYAYKQVLVVLMGSLEAKGNRVVVSTEICDSLSQIFLEPTYFPSLDAAKTFLGDSLNHEHGGGGVRRSRRKQ

Domains

Domain Start-End Description Sequence

HMMPfam: PF07014
IPR009743
1-186 Hs1pro-1_C
Hs1pro-1, C-terminal

RDFEKAASDCYLIERIWKLLAEIEDLHLLMDPDDFLRLKNQLSIKTVDDTESFCFRSKGLVDVTKLCKELRHRVPYILDVEVDPKGGPRIQEAAMRLYSEKKIGSDSDSEKIHVLQALQAIESALKRFYYAYKQVLVVLMGSLEAKGNRVVVSTEICDSLSQIFLEPTYFPSLDAAKTFLGDSLNH

superfamily: SSF140959
2-182 Indolic compounds 2,3-dioxygenase-like

DFEKAASDCYLIERIWKLLAEIEDLHLLMDPDDFLRLKNQLSIKTVDDTESFCFRSKGLVDVTKLCKELRHRVPYILDVEVDPKGGPRIQEAAMRLYSEKKIGSDSDSEKIHVLQALQAIESALKRFYYAYKQVLVVLMGSLEAKGNRVVVSTEICDSLSQIFLEPTYFPSLDAAKTFLGD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox