PRGDB00074322 (Ppe.19013)

From PRG Wiki
Revision as of 16:30, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.19013
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 126656813 (EF409977)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Prunus persica polygalacturonase inhibiting protein (PGIP) mRNA, complete cds

DNA Sequence

TCCGTGGATCCGCAATCACATTTCTTATTCCAAAACCCAAAAAATGGACCTCAAGCTCTCCACCCTTCTCTGCTTGACCCTACTCTTCTCCACCATCCTAAACCCAGCTCTCTCCGAGCTCTGCAACCCGAAAGACAAGAAAGTCCTCCTACAAATCAAGAAAGCCTTCAACAACCCCTACGTCTTGTCCTCATGGGACCCAGAGACAGACTGCTGTGACTGGTACTCTGTCACCTGTGACTCCACCACAAACCGCGTCAACTCCCTCACCCTCTTCTCCGGGGGACTCTCCGGTCAAATTCCGACCCAAGTCGGTGACTTGCCGTATCTTGAAACACTTGAGTTTCACAAGCAACCCAATCTTACCGGACCAATCCAACCCTCCATTGCCAAGCTTAAGCGCCTCAAGGAGCTGCGCCTCAGCTGGACCAACATCTCCGGCTCTGTCCCTGACTTCCTCAGCCAACTCAAAAACCTCACCTTTCTTGAACTCTCATTCAATAACCTCACAGGCTCCATCCCCAGCTCGCTTTCTCAGCTTCCAAACCTAGACGCTCTTCATCTAGACCGTAACAAGCTCACAGGTCATATTCCGAAGTCATTCGGAGAATTCCATGGCAGTGTTCCAGACCTCTATCTCTCTCACAACCAGCTCTCAGGCACCATACCAACCTCATTAGCCAAACTGGACTTCAGCACCGTAGACTTCTCCAGGAACAAGCTCGAAGGCGATGCATCCATGATCTTTGGATTTAACAAGACTACCCAGATTGTGGATCTGTCGAGGAACTTGCTGGAATTTAATCTATCAAAGGTGGAGTTTTCCAAGAGCTTGACTTCGTTGGATCTCAACCATAACAAGATCACAGGCAGTATTCCGGTGGGGCTGACCCAAGTGGATTTGCAGTTCCTGAACGTGAGCTACAACAGGTTGTGTGGTCAGATTCCAGTGGGTGGGAAGTTGCAGAGCTTCGATTCCTCAACATATATCCATAACCAGTGCTTGTGCGGTGCTCCACTCCCAAGCTGCAAATAATTCCCACGTCGACTTTA


Protein sequences

Name Description Sequence
Ppe.19013 translated coding region predicted by ESTScan from UniGene Ppe.19013

MDLKLSTLLCLTLLFSTILNPALSELCNPKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCDSTTNRVNSLTLFSGGLSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLTGHIPKSFGEFHGSVPDLYLSHNQLSGTIPTSLAKLDFSTVDFSRNKLEGDASMIFGFNKTTQIVDLSRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCGAPLPSCK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF918
1-323 PTHR24420:SF918

MDLKLSTLLCLTLLFSTILNPALSELCNPKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCDSTTNRVNSLTLFSGGLSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLTGHIPKSFGEFHGSVPDLYLSHNQLSGTIPTSLAKLDFSTVDFSRNKLEGDASMIFGFNKTTQIVDLSRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCG

HMMPanther: PTHR24420
1-323 PTHR24420,FAMILY NOT NAMED

MDLKLSTLLCLTLLFSTILNPALSELCNPKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCDSTTNRVNSLTLFSGGLSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLTGHIPKSFGEFHGSVPDLYLSHNQLSGTIPTSLAKLDFSTVDFSRNKLEGDASMIFGFNKTTQIVDLSRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCG

superfamily: SSF52058
25-330 SSF52058,LRR

ELCNPKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCDSTTNRVNSLTLFSGGLSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLTGHIPKSFGEFHGSVPDLYLSHNQLSGTIPTSLAKLDFSTVDFSRNKLEGDASMIFGFNKTTQIVDLSRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCGAPLPSCK

Gene3D: G3DSA:3.80.10.10
27-326 G3DSA:3.80.10.10

CNPKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCDSTTNRVNSLTLFSGGLSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLTGHIPKSFGEFHGSVPDLYLSHNQLSGTIPTSLAKLDFSTVDFSRNKLEGDASMIFGFNKTTQIVDLSRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYIHNQCLCGAPL

HMMPfam: PF08263
IPR013210
29-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PKDKKVLLQIKKAFNNPYVLSSWDPETDCCDWYSVTCD

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLKELRLSWTNISGSVPDFLSQL

HMMPfam: PF12799
143-180 LRR_4,Leucine Rich repeats (2 copies)

KNLTFLELSFNNLTGSIPSSLSQLPNLDALHLDRNKLT

ProfileScan: PS51450
IPR001611
144-166 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTFLELSFNNLTGSIPSSLSQL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLDALHLDRNKLTGHIPKSFGEF

ProfileScan: PS51450
IPR001611
193-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVPDLYLSHNQLSGTIPTSLAKLD

HMMPfam: PF00560
IPR001611
197-215 LRR_1
Leucine-rich repeat

LYLSHNQLSGTIPTSLAKL

HMMPfam: PF13516
262-281 LRR_6,Leucine Rich repeat

KSLTSLDLNHNKITGSIPVG

ProfileScan: PS51450
IPR001611
263-285 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLDLNHNKITGSIPVGLTQV

ProfileScan: PS51450
IPR001611
286-308 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLQFLNVSYNRLCGQIPVGGKLQ

HMMPfam: PF00560
IPR001611
287-303 LRR_1
Leucine-rich repeat

LQFLNVSYNRLCGQIPV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox