PRGDB00074324 (Ppe.19081)

From PRG Wiki
Revision as of 16:30, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.19081
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 58379363 (AY903219)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Prunus persica polygalacturonase-inhibiting protein mRNA, complete cds

DNA Sequence

CGTTCACCCGCAATCACATTTCTTATCCAAAACCCACAAAATGGACGTCAAGTTCCCCACCCTCCTCTGCTTGACCCTACTCTTCTCCTCCATCCTAAACCAAGCGCTCTCCGAGCTCTGCAACCCGGAAGACAAGAAAGTTCTCCTACAAATCAAGAAAGCCTTCAACGACCCCTACGTCTTGGCCTCATGGAAGCCAGAGACAGACTGCTGTGACTGGTACTGTGTCACCTGTGACTCCACCACAAACCGCATCAACTCCCTCACCATCTTCTCTGGCCAAGTCTCCGGTCAAATTCCGACCCAAGTCGGTGACTTGCCGTATCTTGAAACACTTGAGTTTCACAAGCAACCCAATCTTACCGGACCAATACAACCCTCCATTGCCAAGCTTAAGCGCCTCAAGGAGCTGCGCCTCAGCTGGACTAACATCTCAGGCTCTGTACCTGACTTCCTCAGCCAACTCAAGAACCTCACCTTTCTTGAGCTCTCATTCAGTAACCTCACAGGCTCCATCCCCAGCTCGCTTTCTCAGCTTCCCAACCTCAACGCTCTTCATCTAGACCGTAACAAGCTCACAGGTCATATTCCGAAGTCATTTGGAGAATTCCATGGCAGTGTTCCAGAGCTCTATCTCTCCCACAACCAGCTCTCAGGCAACATACCAACCTCATTAGCCAAACTGGACTTCAACCGCATAGACTTCTCCCGGAACAAGCTCGAAGGCGATGCATCCATGATCTTTGGATTGAACAAGACAACCCAGATTGTGGATCTGTCTAGGAACTTGCTGGAATTTAATCTGTCAAAGGTGGAGTTTTCCAAGAGCTTGATATCGTTGGATCTTAACCATAACAAGATCACAGGCGGAATTCCGGTGGGGCTGACCCAACTGGATTTGCAGTTCCTGAACGTGAGCTACAACAGGTTGTGTGGTCAGATTCCAGTGGGCGGGAAGTTACAGAGCTTCGACTCCTCAACTTATTTCCATAACCGCTGCTTGTGTGGTGCTCCACTCCCAAGCTGCAAATAATTCCCACGGCCA


Protein sequences

Name Description Sequence
Ppe.19081 translated coding region predicted by ESTScan from UniGene Ppe.19081

XVHPQSHFLSKTHKMDVKFPTLLCLTLLFSSILNQALSELCNPEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLSHNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCKXFPRP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF918
1-337 PGIP1 (POLYGALACTURONASE INHIBITING PROTEIN 1); PROTEIN BINDING

XVHPQSHFLSKTHKMDVKFPTLLCLTLLFSSILNQALSELCNPEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLSHNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCG

HMMPanther: PTHR24420
1-337 FAMILY NOT NAMED,FAMILY NOT NAMED

XVHPQSHFLSKTHKMDVKFPTLLCLTLLFSSILNQALSELCNPEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLSHNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCG

Seg: seg
21-28 seg

TLLCLTLL

superfamily: SSF52058
39-344 L domain-like,LRR

ELCNPEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLSHNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK

Gene3D: G3DSA:3.80.10.10
41-340 no description

CNPEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLEFHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLELSFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLSHNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPL

HMMPfam: PF08263
IPR013210
43-80 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PEDKKVLLQIKKAFNDPYVLASWKPETDCCDWYCVTCD

HMMPfam: PF00560
IPR001611
158-180 LRR_1
Leucine-rich repeat

NLTFLELSFSNLTGSIPSSLSQL

HMMPfam: PF00560
IPR001611
182-202 LRR_1
Leucine-rich repeat

NLNALHLDRNKLTGHIPKSFG

HMMPfam: PF00560
IPR001611
210-229 LRR_1
Leucine-rich repeat

ELYLSHNQLSGNIPTSLAKL

HMMPfam: PF13516
276-294 LRR_6,Leucine Rich repeat

KSLISLDLNHNKITGGIPV

HMMPfam: PF00560
IPR001611
301-317 LRR_1
Leucine-rich repeat

LQFLNVSYNRLCGQIPV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox