PRGDB00074327 (Ppe.19257)

From PRG Wiki
Revision as of 16:30, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.19257
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 53705382 (AJ833372)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

AJ833372 Prunus persica mesocarp S4 climacteric Prunus persica cDNA clone Pp-S4_EST1118, mRNA sequence

DNA Sequence

GCCTACATTGGACAACACACACGTCAGCACAGTTGTAAAAGGCAGCTTTGGGTATTTGGATCCAGAGTACTTTAGGCGGCAACAACTGACAGAAAAATCTGATGTCTACTCATTTGGGGTTGTTCTATTTGAGATCTTATGTGCTCGTCCAGCATTGAACCCGTCACTTCCAAAGGAGCAAGTGAGCTTAGCAGAGTGGGCTGCACATTGCCACAAGAAGGGCAGTCTCGATCATATCCTTGACCCTTATCTCAAGGGGAAGATAACACCAGAATGCTTCAAGAAGTTTGCTGAGACAGCAATGAAATGTGTGTCAGATCAAAGCATTGACAGGCCATCAATGGGAGATGTGCTTTGGAACCTTGAGTTTGCTTTGCAGCTACAGGAGAGTGCTGAGGAGAGTGGCAAGGGTATTGGTGCAATGGAACTTGAGGAAGAGCCGTTCATGGCCTGCAAAGGGAAGAAGTACCCTGATGCAGTGCCTGCCTTTGATGGTAATGTGACAGACTCAAGGAGCAGCGGGATGAGCATGAGCATAGGTGGCCGGAGCCTAGCTAGCGATGACTCTGATGGATTGACACCAAGTGCTGTGTTCTCACAGATCATGAACCCTAAAGGACGTTAAGAAGATTGAAGATATGGCTCCTCCCCTTAATCAATCAGGCAATGAAGTTTGCTGTATTTCTTTTTCCAAATTTTCATTCATTTAAGTTACTGTTATTTTC


Protein sequences

Name Description Sequence
Ppe.19257 translated coding region predicted by ESTScan from UniGene Ppe.19257

XPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQLQESAEESGKGIGAMELEEEPFMACKGKKYPDAVPAFDGNVTDSRSSGMSMSIGGRSLASDDSDGLTPSAVFSQIMNPKGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-125 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFA

HMMPanther: PTHR24420:SF418
2-189 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQLQESAEESGKGIGAMELEEEPFMACKGKKYPDAVPAFDGNVTDSRSSGMSMSIGGRSLASDD

HMMPanther: PTHR24420
2-189 FAMILY NOT NAMED,FAMILY NOT NAMED

PTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQLQESAEESGKGIGAMELEEEPFMACKGKKYPDAVPAFDGNVTDSRSSGMSMSIGGRSLASDD

superfamily: SSF56112
IPR011009
5-124 Protein kinase-like (PK-like)
Protein kinase-like domain

DNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEF

Gene3D: G3DSA:1.10.510.10
9-124 no description

VSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEF

HMMPfam: PF07714
IPR001245
10-119 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

STVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVL

Seg: seg
171-184 seg

SRSSGMSMSIGGRS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox