PRGDB00074332 (Ppe.20133)

From PRG Wiki
Revision as of 16:31, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.20133
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209179949 (FC866366)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PPN025A04-T7 PPN Prunus persica cDNA clone PPN025A04, mRNA sequence

DNA Sequence

GATGTCAGCGGAAACATCTTGTCAGGTTCAATACCTGAATATTTTAACAGCACTTGTGCTCCAGTTTCTCCCTTGACAGATTTTTCTTTCAAAGATGATGATCCGTCCTCGCCCTATTTAGCATTTTTTGCATCGAAAACCCAAGTTGGAAACCCGTTGCAACTGTACGGAGAAGATGATGGTCTTACAGTACTGCACAACTTTGGGGACAATAATTTTACTGGCACTTTGCCGTCACTGCCTATTGCACATGAAAGATTAGGGAAGCAAACTCTTTATGCATTCCTTGTTGGAGAAAACAAGCTTACTGGAACATTTCCAGGTAGTTTATTTGGGAAGTGTGAGGGATTGGATTCATTGGTTGTTAATGTGAGTAACAACAAGCTATATGGTCAGATTCCTGCCGAAGTTGGCACAATGTGCAAATCTCTTAAATTTTTAGATGCATCTCGGAATCAGATTATTGGTCCCATTCCCCCTACTTTTGGGAAATTGGTGTCCCTTGTTGCCCTTAACCTGAGTTGGAACATGTTGCATGGTCAGATCCCCATCAGTCTTGGCCAGACAAGGGATCTGAGGTATCTGTCCTTATCTGGTAATAACCTTACAGGTACCATTCCATCTAGTTTGGGGCAGCTTTACTCTTTAGAAGTGCTGGAGCTTTCTTCAACCATCTCACCGGTGAGATACCAAGGATCTTGTGACTTGGGAATCTGACTGTCTCTGCTGTACAAATATCTTCTGGTCAGATCATCTGGTTGGCATGGACTGCCCCTCTTC


Protein sequences

Name Description Sequence
Ppe.20133 translated coding region predicted by ESTScan from UniGene Ppe.20133

DVSGNILSGSIPEYFNSTCAPVSPLTDFSFKDDDPSSPYLAFFASKTQVGNPLQLYGEDDGLTVLHNFGDNNFTGTLPSLPIAHERLGKQTLYAFLVGENKLTGTFPGSLFGKCEGLDSLVVNVSNNKLYGQIPAEVGTMCKSLKFLDASRNQIIGPIPPTFGKLVSLVALNLSWNMLHGQIPISLGQTRDLRYLSLSGNNLTGTIPSSLGQLYSLEVLELSSTISPVRYQGSCXLGNLTVSAVQISSGQIIWLAWTAPLX


Domains

Domain Start-End Description Sequence

Seg: seg
27-38 seg

DFSFKDDDPSSP

superfamily: SSF52058
67-223 L domain-like,LRR

NFGDNNFTGTLPSLPIAHERLGKQTLYAFLVGENKLTGTFPGSLFGKCEGLDSLVVNVSNNKLYGQIPAEVGTMCKSLKFLDASRNQIIGPIPPTFGKLVSLVALNLSWNMLHGQIPISLGQTRDLRYLSLSGNNLTGTIPSSLGQLYSLEVLELSS

Gene3D: G3DSA:3.80.10.10
67-223 no description

NFGDNNFTGTLPSLPIAHERLGKQTLYAFLVGENKLTGTFPGSLFGKCEGLDSLVVNVSNNKLYGQIPAEVGTMCKSLKFLDASRNQIIGPIPPTFGKLVSLVALNLSWNMLHGQIPISLGQTRDLRYLSLSGNNLTGTIPSSLGQLYSLEVLELSS

HMMPanther: PTHR24420:SF99
99-223 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ENKLTGTFPGSLFGKCEGLDSLVVNVSNNKLYGQIPAEVGTMCKSLKFLDASRNQIIGPIPPTFGKLVSLVALNLSWNMLHGQIPISLGQTRDLRYLSLSGNNLTGTIPSSLGQLYSLEVLELSS

HMMPanther: PTHR24420
99-223 FAMILY NOT NAMED,FAMILY NOT NAMED

ENKLTGTFPGSLFGKCEGLDSLVVNVSNNKLYGQIPAEVGTMCKSLKFLDASRNQIIGPIPPTFGKLVSLVALNLSWNMLHGQIPISLGQTRDLRYLSLSGNNLTGTIPSSLGQLYSLEVLELSS

HMMPfam: PF00560
IPR001611
143-165 LRR_1
Leucine-rich repeat

SLKFLDASRNQIIGPIPPTFGKL

HMMPfam: PF00560
IPR001611
192-213 LRR_1
Leucine-rich repeat

LRYLSLSGNNLTGTIPSSLGQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox