PRGDB00074334 (Ppe.20402)

From PRG Wiki
Revision as of 16:31, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.20402
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209178981 (FC865542)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN011E06-T7 PPN Prunus persica cDNA clone PPN011E06, mRNA sequence

DNA Sequence

GTGAGCAAGCAGAAGGTGCTCAAGGGCGGGTTTACGGCGCACGTTAAGCGGGAGATCTCTATCATGCGCCGGCTACGCCACCCCCACATCGTTAAGCTGTACGAGGTGTTAGCCACGAAAACTAAGATCTACTTCATTATGGAGTTCGCCAAAGGCGGCGAGCTCTTCGCCAAAATATCCAAGGGCCGGTTCAGCGAAGACCTCAGCCGCCGGTATTTCCAGCAGCTGATCTCTGCCATCGGATATTGCCACTCCCGCGGAGTATTTCACCGCGACTTGAAGCCCGAGAATTTGCTGCTGGACGAGAACTGGAATTTGAAGGTTTCGGACTTCGGGCTCAGCGCCGTGACGGAGCAGGTCCGACCCGACGGGCTGCTCCACACGCTATGCGGGACCCCCGCGTACGTGGCTCCCGAAATTCTCGGGAAGAAAGGATACGAAGGTGCGAAGGTGGATATCTGGTCATGCGGCATCATCTTGTTCGTTTTGAACTCGGGTTATTTGCCTTTCAACGACCAGAATCTGATGGTGATGTATCGGAAGATTTATAAGGGCGATTTTCGGTTCCCAAGATGGACGTCGCCCGATCTAAGAAGACTGATTTCGAGCCTTCTGGACACGAACCCCGAGACGAGGATCACCGTAGATGAGATTCTGAAGGACCCTTGGTTCGGGAAAGGA


Protein sequences

Name Description Sequence
Ppe.20402 translated coding region predicted by ESTScan from UniGene Ppe.20402

VSKQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWFGKG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-224 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VSKQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWF

HMMSmart: SM00220
IPR002290
1-224 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VSKQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWF

HMMSmart: SM00219
IPR020635
1-222 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VSKQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDP

HMMPanther: PTHR24343:SF45
3-227 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

KQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWFGKG

HMMPanther: PTHR24343
3-227 FAMILY NOT NAMED,SERINE/THREONINE KINASE

KQKVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWFGKG

superfamily: SSF56112
IPR011009
5-224 Protein kinase-like (PK-like)
Protein kinase-like domain

KVLKGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWF

Gene3D: G3DSA:3.30.200.20
8-66 no description

KGGFTAHVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSE

HMMPfam: PF00069
IPR017442
14-224 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HVKREISIMRRLRHPHIVKLYEVLATKTKIYFIMEFAKGGELFAKISKGRFSEDLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWF

Gene3D: G3DSA:1.10.510.10
67-224 no description

DLSRRYFQQLISAIGYCHSRGVFHRDLKPENLLLDENWNLKVSDFGLSAVTEQVRPDGLLHTLCGTPAYVAPEILGKKGYEGAKVDIWSCGIILFVLNSGYLPFNDQNLMVMYRKIYKGDFRFPRWTSPDLRRLISSLLDTNPETRITVDEILKDPWF

PatternScan: PS00108
IPR008271
88-100 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDLKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox