PRGDB00074336 (Ppe.20505)

From PRG Wiki
Revision as of 16:31, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ppe.20505
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209175908 (FC865303)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN011C11-T7 PPN Prunus persica cDNA clone PPN011C11, mRNA sequence

DNA Sequence

GAGCGTTTGGCGAATTTGATCGGGTGCTGCTGCGAGGGTGATGAGAGATTGCTTGTCGCTGAGTTCATGCCCAATGAAACTCTCTCTAAGCATCTTTTCCATTGGGAGACCCAGCCGATGAAATGGGCGATGAGGTTGCGAGTGGCTTTGTATCTTGCACAAGCTTTAGATTATTGCAGCAGTAAAGGGCAGGCATTGTACCATGATCTTAATGCTTACAGAGTCCTATTCGATCAGGATGAGAATCCCAGACTCTCCTGCTTTGGTCTAATGAAGAATAGCAAAGATGGGAAGAGCTATAGTACCAACCTGGCTTTCACCCCTCCAGAGTACTTGAGGACAGGAAGAGTGATACCAGAAAGTTTGGTTTACAGCTTTGGTACCCTGTTGCTTGATCTGCTCAGTGGGAAACATATCCCTCCAAGTCATGCACTTGACCTGATACGGGGCAAAAACTTTTTGATGCTGATTGACTCGTGCTTGGAAGGTCATTTCTCAAATGATGATGGGACTGAGCTGGTGAGGTTAGCTTCACGATGCTTGCAGTATGAACCTCGTGAGAGGCCAAATGCCAAGTCTCTTGTGACTGCCCTCATTCCTCTTCAAAAAGAAACTGAGGTTCCATCATATGTTTTGCTGGGTATTCCGCATGGAAATGCACCTCTGAATCAGACATTGCTATCACCTCTAGGTGAAGCTTGCTCGAGACTGGATCTTTACTGCATACATGAAATACTGGAGAAGCTT


Protein sequences

Name Description Sequence
Ppe.20505 translated coding region predicted by ESTScan from UniGene Ppe.20505

ERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALIPLQKETEVPSYVLLGIPHGNAPLNQTLLSPLGEACSRLDLYCIHEILEKL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF457
1-249 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALIPLQKETEVPSYVLLGIPHGNAPLNQTLLSPLGEACSRLDLYCIHEILEKL

HMMPanther: PTHR24420
1-249 FAMILY NOT NAMED,FAMILY NOT NAMED

ERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALIPLQKETEVPSYVLLGIPHGNAPLNQTLLSPLGEACSRLDLYCIHEILEKL

ProfileScan: PS50011
IPR000719
1-202 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALIPLQ

HMMSmart: SM00220
IPR002290
1-199 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALI

HMMPfam: PF07714
IPR001245
2-198 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

RLANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTAL

superfamily: SSF56112
IPR011009
3-221 Protein kinase-like (PK-like)
Protein kinase-like domain

LANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALIPLQKETEVPSYVLLGIPHGNAP

HMMSmart: SM00219
IPR020635
3-198 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTAL

Gene3D: G3DSA:1.10.510.10
4-197 no description

ANLIGCCCEGDERLLVAEFMPNETLSKHLFHWETQPMKWAMRLRVALYLAQALDYCSSKGQALYHDLNAYRVLFDQDENPRLSCFGLMKNSKDGKSYSTNLAFTPPEYLRTGRVIPESLVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLIDSCLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox